KEGG   Klebsiella oxytoca KCTC 1686: KOX_12315Help
Entry
KOX_12315         CDS       T01681                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:kox00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2661757..2662731)
Genome map
AA seq 324 aa AA seqDB search
MTDLITRPRRLRKSASLRAMFEETTLSLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPERH
LAREIERIANAGIRSVMTFGISHHTDAVGSDTWNENGLVARMSRICKEAVPEMIVMSDTC
FCEYTSHGHCGVLCDHGVDNDLTLSNLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMSPMNRREAIRESLLDEAQG
ADCLMVKPAGPYLDILRDLRERTNLPLGAYQVSGEYAMIKFAAQAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttaatcactcgcccgcgccgactgcgcaagtccgcttcgctacgtgccatg
tttgaagagacaacactgagtttgaacgacctggtgttgccgatctttgttgaagaagaa
atcgacgattacaaagccatcgaagcgatgcccggcgtgatgcgtattccggaaagacac
ctggcgcgcgaaatcgagcgcattgccaacgccggtatccgttcggtgatgaccttcggc
atttcccatcataccgatgccgttggcagcgatacctggaacgaaaacggcctggtagcg
cgcatgtcccgcatctgtaaagaggcggtgccggagatgatcgtaatgtccgacacctgt
ttctgcgaatacacctcccacggccactgcggcgtgctgtgcgaccacggtgtcgataac
gatttaacccttagcaacctcggtaagcaggcggtggtcgccgctgccgcaggcgcggat
tttatcgccccgtccgccgcgatggacggccaggtgcaggccattcgccaggcgctggac
gccgccggatttaccgatacggcgattatgtcctactccaccaagttcgcttcatcgttc
tatggtccgttccgcgaagccgcgggtaccgcgctgaaaggcgatcgtaaaacctatcag
atgagcccgatgaaccgccgcgaagcgattcgcgaatcgctgctggacgaagcccagggc
gccgactgcctgatggtcaaaccggccggtccctatctcgatatcctgcgcgatctgcgc
gagcgcaccaacctgccgctcggcgcgtaccaggtgagcggtgaatacgcgatgattaag
ttcgccgcccaggccggcgctatcgatgaagagaaagtggtgctggaaagcctcggcgca
atcaagcgcgccggcgcggatctgatcttcagctacttcgccctcgatctcgccgaaaag
aaaatcctgcgttaa

DBGET integrated database retrieval system