KEGG   Klebsiella oxytoca KCTC 1686: KOX_12385Help
Entry
KOX_12385         CDS       T01681                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KOX_12385
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KOX_12385
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KOX_12385
Enzymes [BR:kox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KOX_12385
Exosome [BR:kox04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KOX_12385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2675329..2676744
Genome map
AA seq 471 aa AA seqDB search
MKLSALFIALLPLLGSPIIHAETTTAPVLENRAAQGDITTPGGARRLSGDQTEALRASLI
NKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKSYNGALGVDIHEKDHQTILELAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCASNALEKGGKGSITEQLLNARPDVTLGGGAKTFAESATAG
EWQGKTLHDQAVARGYQIVTDASSLAAISQANQDKPLLGLFAEGNMPVRWEGPKASYHGN
IDKAAVTCTPNPKRDASVPTLAQMTEKAIDLLSSNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFAKKEGNTLVIVTADHAHASQIIPADTKAPGLTQALNTKDGSVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALNLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaagcgccctgtttattgccctgctgcctctgctgggctccccgattattcac
gcagaaacaacaaccgcaccggttctggaaaatcgtgccgcgcagggcgatatcaccacg
ccgggcggcgcgcgtcgtttaagcggtgaccagaccgaggcgctgcgcgcttcgttaatc
aataaaccggctaaaaatattattttgctgattggcgacggaatgggcgattctgaaatc
accgccgcgcgaaattatgcagaaggggcgggcggcttctttaaaggcattgacgcgctg
ccgctgaccggccagtacacccattattctctggataagaaaaccggcaagccggattat
gtcaccgactccgccgcttccgcaacggcctggaccaccggcgtgaaaagctataacggc
gcgctgggcgtggatatccatgaaaaagatcatcagaccatccttgagctggcgaaagcg
gcgggcttagctaccggtaacgtctccacggcggaactgcaggacgccactcccgctgcg
ctggtggcgcatgtgacgtcgcgtaaatgctacggcccgagcgtgaccagcgaaaaatgc
gccagcaacgcgctggaaaagggcggtaaaggttcgattaccgaacagctgctgaacgcc
cgtcccgacgtaacactgggcggcggtgcgaaaaccttcgcggaaagcgcgacggccggt
gaatggcagggcaaaacgctgcacgatcaggcggtagcccgcggctaccagatcgtcacc
gacgccagctcgctggccgccattagccaggccaatcaggacaaaccgctgctcggtctc
ttcgcggaaggcaatatgccggtgcgttgggaaggcccaaaggcgtcttatcacggcaat
atcgataaggcggcggtgacctgtacgccgaacccgaaacgcgatgcatcggtgccgacg
ctggcgcagatgaccgaaaaagccatcgatctgctgagcagcaatgagaaggggttcttc
ctgcaggtggaaggcgcttctatcgataaacaggatcacgcggcgaatccgtgcggtcag
attggcgagaccgtcgatctggacgaagcggtacagaaggcgctggaatttgccaaaaaa
gagggcaataccctggttatcgtcaccgccgaccacgctcacgccagccagattatcccg
gcagataccaaagcgccgggcctgacgcaggcgctgaacaccaaagatggttcggtgatg
gtgatgagctacggcaactctgaagaagagtcgatggaacataccggcacccagctgcgt
attgccgcctacggcccgcacgcggccaacgtggtgggtttaaccgaccagacggacctg
ttctacaccatgaaagccgcacttaatctgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system