KEGG   Klebsiella oxytoca KCTC 1686: KOX_13040Help
Entry
KOX_13040         CDS       T01681                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kox00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KOX_13040 (recR)
DNA repair and recombination proteins [BR:kox03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      KOX_13040 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2811443..2812048
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRKENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLRDESMQEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagtccgctgttaacgcagcttatggaagcactgcgctgcctgccgggtgtc
ggcccgaagtcggcgcagcgcatggcgtttaccctgctgcagcgcgaccgcagcggcgga
atgcgcctggcgcaggcgctaacgcgcgcgatgtcggaaatcggccactgcgccgattgc
cgtaccttcaccgagcaggaggtgtgcaatatttgcagcaaccctcggcgcaaggaaaac
ggccagatctgcgtggtagagagcccagcggatatctacgctatcgagcagaccgggcag
ttttccggtcgctactttgtgctgatgggccacctgtcgccgcttgacggtatcgggccg
gatgacattgggctcgatcgtctggaacagcgtctgcgtgacgaatcgatgcaggaagtg
atcctcgcgaccaacccaacggtagaaggggaggcgacggccaattatatcgccgagctc
tgcgcgcagtatggcgtagacgcgagccgtatcgcccatggcgtaccggtcggcggcgag
ctggagatggttgacggcacgacgctatcccactcgctcgccgggcggcataagattcgt
ttttaa

DBGET integrated database retrieval system