KEGG   Klebsiella michiganensis KCTC 1686: KOX_13040Help
Entry
KOX_13040         CDS       T01681                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:kox00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KOX_13040 (recR)
DNA repair and recombination proteins [BR:kox03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     KOX_13040 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      KOX_13040 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim FYVE_2 HHH Toprim_2 HHH_5
Motif
Other DBs
NCBI-ProteinID: AEX04332
UniProt: A0A0H3H9R0
Position
2811443..2812048
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRKENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLRDESMQEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagtccgctgttaacgcagcttatggaagcactgcgctgcctgccgggtgtc
ggcccgaagtcggcgcagcgcatggcgtttaccctgctgcagcgcgaccgcagcggcgga
atgcgcctggcgcaggcgctaacgcgcgcgatgtcggaaatcggccactgcgccgattgc
cgtaccttcaccgagcaggaggtgtgcaatatttgcagcaaccctcggcgcaaggaaaac
ggccagatctgcgtggtagagagcccagcggatatctacgctatcgagcagaccgggcag
ttttccggtcgctactttgtgctgatgggccacctgtcgccgcttgacggtatcgggccg
gatgacattgggctcgatcgtctggaacagcgtctgcgtgacgaatcgatgcaggaagtg
atcctcgcgaccaacccaacggtagaaggggaggcgacggccaattatatcgccgagctc
tgcgcgcagtatggcgtagacgcgagccgtatcgcccatggcgtaccggtcggcggcgag
ctggagatggttgacggcacgacgctatcccactcgctcgccgggcggcataagattcgt
ttttaa

DBGET integrated database retrieval system