KEGG   Klebsiella oxytoca KCTC 1686: KOX_13165Help
Entry
KOX_13165         CDS       T01681                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    KOX_13165
Enzymes [BR:kox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     KOX_13165
   3.1.2  Thioester hydrolases
    3.1.2.-  
     KOX_13165
Lipid biosynthesis proteins [BR:kox01004]
 Fatty acid synthase
  Component type
   KOX_13165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2840447..2841070)
Genome map
AA seq 207 aa AA seqDB search
MNFKYVFRWHLPFLFLVLFTCRAMAADTLLVLGDSLSAGYRMAGNTAWPALLNDKWQTKT
PVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFPPQQTEQTLRTIIEHI
KAANAQPLLMQIRLPANYGRRYNEAFSAIYPALAKEFDIPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMATRLAPLVNHDS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagtatgttttccgctggcatttgcctttcctgtttctggtcctgtttacc
tgccgcgcgatggcggccgacacgctgttggttctcggcgacagtctgagcgccggttat
cgcatggcgggcaataccgcctggcctgcgctgcttaacgataagtggcagaccaaaacg
ccggtggttaacgccagcatcagcggcgatacctcgcagcaggggctggcaaggctgccg
gctctgcttaagcagcatcagccgcgctgggtgctggtagagctgggcggtaacgacggg
ctgcgcggtttcccgccgcagcagacggagcagacgctgcgtaccattattgagcatatc
aaagcggcgaacgcccagccgctgctgatgcaaattcgcctgcccgccaactatggccgc
cgttataatgaagcctttagcgcaatttatccggcactggccaaagagtttgatattcct
ctgctgcccttttttatggaagaggtttatctgaaaccgcagtggatgcaggacgatgga
attcaccctaatcgcgacgcccagccgtttatcgccgactggatggcgacgcgtttggct
cccttagttaatcatgactcctga

DBGET integrated database retrieval system