KEGG   Klebsiella oxytoca KCTC 1686: KOX_14575Help
Entry
KOX_14575         CDS       T01681                                 

Gene name
sdhD
Definition
succinate dehydrogenase cytochrome b556 small membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_14575 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KOX_14575 (sdhD)
   00650 Butanoate metabolism
    KOX_14575 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    KOX_14575 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3162247..3162594
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATTGEISWEVWTGFFSSAFTKVF
TLLALVSILIHAWIGMWQVLTDYVKPLAVRLILQLLIVVALVAYVLYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctcagcactaggacgcaacggcgtacatgactttattctggtccgt
gctaccgctatcgttctgaccctctacatcatctatatggttggcttctttgccaccacc
ggtgaaatttcatgggaagtctggacgggctttttctcctccgcgttcactaaagtcttc
accctgctggctctcgtttccattctgatccacgcctggatcgggatgtggcaggtatta
acggactacgttaaaccactggccgtgcgcttaattctgcaactgctgatcgttgttgcg
ctggtggcttacgttctttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system