KEGG   Klebsiella oxytoca KCTC 1686: KOX_14595Help
Entry
KOX_14595         CDS       T01681                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_14595
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KOX_14595
  Amino acid metabolism
   00310 Lysine degradation
    KOX_14595
Enzymes [BR:kox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KOX_14595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3168294..3169520
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
IEDEGATVLSRQILGRLREGNSAGKESGAKADAKESTPAQRQQASLEEQNNDALSPAIRR
LLAEHSLDAAAIKGTGVGGRLTREDVEKHLASAPAKAEAPAAAPAAAAAPAAQLGNRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDLLGMADIEK
KIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VNGKVEILPMMYLALSYDHRLIDGRESVGYLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcccgacctgcctgagtccgtagctgacgcaacggtt
gccacctggcataaaaaaccgggcgatgcggttgttcgtgacgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcttcagcggatggcattctggacgcggtg
attgaagacgaaggcgctaccgtgctctctcgtcagatcctcggccgcctgcgtgaaggc
aacagcgcgggcaaagagtccggtgcgaaagccgatgccaaagagtcgacgccggcccag
cgccagcaggcttctctggaagaacaaaacaacgatgcgctgagcccggcgattcgccgt
ctgctggcggaacacagcctcgacgcggcggccattaaaggcaccggcgttggcggccgc
ctgacccgtgaagacgtggagaagcatctggcgagcgcgccggctaaagctgaagcgccg
gcggctgctcccgctgctgctgctgctccggcggcgcagctgggcaaccgctcggaaaaa
cgcgtgccgatgacccgtctgcgcaaacgcgttgccgagcgtctgctggaagcgaaaaac
tccaccgccatgctgacgaccttcaacgaagtcaacatgaagccgattatggatctgcgt
aagcagtacggtgacgcgtttgaaaaacgtcacggtatccgcctgggcttcatgtccttc
tacgtgaaggcggtcgtggaagcgctgaaacgctatccggaagtgaacgcctctatcgat
ggcgacgacgtggtgtaccacaactatttcgacgtcagcatggcggtctccacgcctcgc
ggcctggtcaccccggttctgcgcgacgtcgatctgctgggcatggcggatatcgagaag
aaaattaaagagctggcagtaaaaggccgcgacggcaagctgaccgtagacgacctgacc
ggcggtaacttcaccattaccaacggcggcgtattcggttctctgatgtccacgccgatc
atcaacccgccgcagagcgcgattctgggtatgcatgccattaaagatcgtccgatggcg
gtgaatggtaaggtggaaattctgccgatgatgtacctggcgctctcctacgaccatcgt
ctgatcgacggacgtgagtcggttggctacctggttgcgattaaagagctgctggaagac
ccgactcgtctgctgctggacgtgtag

DBGET integrated database retrieval system