KEGG   Klebsiella michiganensis KCTC 1686: KOX_14595Help
Entry
KOX_14595         CDS       T01681                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00020  Citrate cycle (TCA cycle)
kox00310  Lysine degradation
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01200  Carbon metabolism
Module
kox_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kox_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KOX_14595
  Amino acid metabolism
   00310 Lysine degradation
    KOX_14595
Enzymes [BR:kox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KOX_14595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AEX04643
UniProt: A0A0H3H8G5
Position
3168294..3169520
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
IEDEGATVLSRQILGRLREGNSAGKESGAKADAKESTPAQRQQASLEEQNNDALSPAIRR
LLAEHSLDAAAIKGTGVGGRLTREDVEKHLASAPAKAEAPAAAPAAAAAPAAQLGNRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDLLGMADIEK
KIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VNGKVEILPMMYLALSYDHRLIDGRESVGYLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcccgacctgcctgagtccgtagctgacgcaacggtt
gccacctggcataaaaaaccgggcgatgcggttgttcgtgacgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcttcagcggatggcattctggacgcggtg
attgaagacgaaggcgctaccgtgctctctcgtcagatcctcggccgcctgcgtgaaggc
aacagcgcgggcaaagagtccggtgcgaaagccgatgccaaagagtcgacgccggcccag
cgccagcaggcttctctggaagaacaaaacaacgatgcgctgagcccggcgattcgccgt
ctgctggcggaacacagcctcgacgcggcggccattaaaggcaccggcgttggcggccgc
ctgacccgtgaagacgtggagaagcatctggcgagcgcgccggctaaagctgaagcgccg
gcggctgctcccgctgctgctgctgctccggcggcgcagctgggcaaccgctcggaaaaa
cgcgtgccgatgacccgtctgcgcaaacgcgttgccgagcgtctgctggaagcgaaaaac
tccaccgccatgctgacgaccttcaacgaagtcaacatgaagccgattatggatctgcgt
aagcagtacggtgacgcgtttgaaaaacgtcacggtatccgcctgggcttcatgtccttc
tacgtgaaggcggtcgtggaagcgctgaaacgctatccggaagtgaacgcctctatcgat
ggcgacgacgtggtgtaccacaactatttcgacgtcagcatggcggtctccacgcctcgc
ggcctggtcaccccggttctgcgcgacgtcgatctgctgggcatggcggatatcgagaag
aaaattaaagagctggcagtaaaaggccgcgacggcaagctgaccgtagacgacctgacc
ggcggtaacttcaccattaccaacggcggcgtattcggttctctgatgtccacgccgatc
atcaacccgccgcagagcgcgattctgggtatgcatgccattaaagatcgtccgatggcg
gtgaatggtaaggtggaaattctgccgatgatgtacctggcgctctcctacgaccatcgt
ctgatcgacggacgtgagtcggttggctacctggttgcgattaaagagctgctggaagac
ccgactcgtctgctgctggacgtgtag

DBGET integrated database retrieval system