KEGG   Klebsiella oxytoca KCTC 1686: KOX_14645Help
Entry
KOX_14645         CDS       T01681                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KOX_14645
   00330 Arginine and proline metabolism
    KOX_14645
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    KOX_14645
Enzymes [BR:kox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     KOX_14645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3176673..3177674)
Genome map
AA seq 333 aa AA seqDB search
MNVKFLGTCILTASLLFSAAAQAQSAPDYASIIEQAHQKYKSNHDGKVADYIPALASYSP
NNFAITLATVEGKIYQTGDVTKAFPMESLSKVFTLALAMEQRGPQEVLDKLGANATGLPF
NSGLAVELTQGAPENPLVNAGAMSTVSLIAAKDKTDRWNNILNNLNAWADSSLSVNEPVF
QSEMETNQHNQALAMLMNSYRSFYGDPQEAVEIYTRQCSVDITVEQLAKMGAVLANNGKS
PFNGKQLLTASYVPQVLAEMAIAGLYDGSGKWLYTVGIPAKSGVGGGMVAVVPGQYAIAV
YSPPLDAAGNSVRAQQTIEYVANATRANLFLAK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgaaatttcttggcacctgcatcttaaccgccagcttactgtttagcgccgcc
gcgcaggcgcaaagcgcgccggactacgccagcatcatcgagcaggcacatcagaaatat
aagagtaatcacgacggtaaagtcgccgactatatccctgccctggcgagctatagcccg
aataatttcgccattacgctcgcgacggtcgaaggcaaaatttaccagaccggcgacgtg
acaaaagcctttccgatggaatccttaagtaaagttttcaccctggcgctggcaatggag
cagcgcgggccgcaggaggtgctggataaactcggcgcgaacgcgaccggcctgcccttc
aattccggcttagccgtcgagctcacgcaaggcgcgccggagaacccgttagtcaacgcc
ggcgccatgagcaccgtgagcctgattgcggcgaaagacaaaaccgaccgctggaacaac
attctcaacaacctcaacgcctgggccgacagctccctgagcgttaacgagccggtattt
caatccgaaatggagaccaatcagcataaccaggcgctggcgatgctgatgaattcatac
cgcagcttctatggcgaccctcaggaagccgtcgaaatctacacccgtcagtgttcggtg
gatatcaccgttgagcagctcgccaaaatgggggccgtactcgccaacaatggcaaatca
ccgttcaacggcaagcagctgctcaccgccagctacgtcccgcaggtgctggcggaaatg
gcgatcgccgggctgtacgacggcagcggcaaatggctgtacaccgtcggtatcccggca
aaatccggcgttggcggcggaatggtcgccgtcgttcccgggcaatacgctatcgccgtc
tactcccctccgctggatgcagccggcaacagcgtccgcgcccagcagaccatcgagtac
gtcgcgaatgcgacgcgggccaatctctttttagcgaaatag

DBGET integrated database retrieval system