KEGG   Klebsiella michiganensis KCTC 1686: KOX_14765Help
Entry
KOX_14765         CDS       T01681                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00010  Glycolysis / Gluconeogenesis
kox00260  Glycine, serine and threonine metabolism
kox00680  Methane metabolism
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01200  Carbon metabolism
kox01230  Biosynthesis of amino acids
Module
kox_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kox_M00002  Glycolysis, core module involving three-carbon compounds
kox_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_14765 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    KOX_14765 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KOX_14765 (gpmA)
Enzymes [BR:kox01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KOX_14765 (gpmA)
Membrane trafficking [BR:kox04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    KOX_14765 (gpmA)
Exosome [BR:kox04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KOX_14765 (gpmA)
  Exosomal proteins of melanoma cells
   KOX_14765 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEX04677
UniProt: A0A0H3HAU9
Position
complement(3202304..3203056)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVGEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEAEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactcgttcgtcacggcgaaagccaatggaacaacgaaaac
cgtttcaccggttggtatgacgttgacctgtctgaaaaaggcgtgggtgaagcaaaagcg
gccggtaagctgctgaaagaagaaggcttcagcttcgactttgcttatacctctgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgaactggatcaggcctggctgccg
gtagaaaagtcatggaaactgaacgagcgtcactacggtgcgctgcagggcctcaacaaa
gcggaaaccgctgaaaaatacggtgacgagcaggttaagcagtggcgtcgcggctttgcg
gtaacgccgccggagctgaccaaagacgacgagcgctacccgggtcacgatccgcgctat
gcaaaactgaccgacgctgagctgcctaccaccgagagcctggcgctgaccatcgaccgc
gtcgtaccgtactggaatgaaaccattctgccgcgtctgaaaagcggtgagcgcgtgatt
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctcgacaacatgggcgaa
gcagagatcctcgagctgaacatcccgaccggcgtaccgctggtgtatgagttcgacgag
aacttcaagcctattaaacattactatctgggtaacgccgacgagatcgccgcgaaagcc
gctgccgtagcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system