KEGG   Klebsiella michiganensis KCTC 1686: KOX_14875Help
Entry
KOX_14875         CDS       T01681                                 

Definition
(GenBank) acyl-CoA thioesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00040  Pentose and glucuronate interconversions
kox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KOX_14875
Enzymes [BR:kox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     KOX_14875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-ProteinID: AEX04699
UniProt: A0A0H3H874
Position
complement(3222326..3223609)
Genome map
AA seq 427 aa AA seqDB search
MNTYSVSRLALALAFGVTLSACSSTPADQQPSTQTAPGTASRPVLTADEAKNFLPASYFQ
SLDPNAAAWSPSAISLPAQPDFVVGPAGTQGVTHTTIQAAVDAAITRHSNRRQFIAIMPG
EYAGTVYVPAAPGALTLYGTGEKPIDVKISAAIDSEMDPVSWRHQVNPGGKYMPGKPAWY
MYDSCQSRRAATVGVMCSAVFWSQNNDLQLQNLTIANNLGDSVDAGTHQAVALRSDGDRV
QINKVNILGRQNTFFVTNSGVQNRLQDNRQTRTLVSNSYIEGDVDIVSGRGAVVFDNTDF
RVVNSRTQKEGYVFAPATLKSVTYGFLAINSRFTASGDNVAQLGRSLDVDGNTNGQVVIR
DSVINEGFNIAKPWADAVGSNRPFSGNTGTADAKGNPQRNLNDANFNRMWEYNNRGVGSF
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatattccgtttcccgcctggcgctggcgctggcctttggcgtgacgttgtcc
gcctgtagttcgacgcctgccgatcaacagccctcaacgcaaacagcgccgggcacggcc
tctcgtccagttttaaccgccgatgaggcgaaaaacttcttaccagcgagctatttccag
tctctcgatcctaacgccgctgcgtggagcccgtccgccatcagcctcccggcgcagccg
gattttgtcgtgggtcctgcgggtacccagggggtaacccacaccacgattcaggccgcg
gtggatgcagcgattacccgccactccaatcgtcgtcagtttatcgccatcatgccgggt
gaatatgcgggcaccgtatacgttccggcggcgcctggcgcgctgaccctgtacggcacc
ggtgagaagccgattgatgtaaaaatcagcgcagcgattgattcagaaatggatccggtc
tcctggcgtcaccaggttaatccgggcggcaaatatatgccgggcaaaccggcctggtat
atgtacgacagctgccagagcagacgtgccgccaccgttggcgtgatgtgctcagcggta
ttctggtcgcagaataacgatctccagctacagaacctgactatcgccaacaacctcggc
gacagcgtagacgcgggcacccatcaggccgtggcgctgcgtagcgatggcgatcgggta
cagattaacaaggtgaatatcctcggtcgccagaacacctttttcgtgaccaacagcggc
gtacaaaaccgcctgcaggataaccgtcagacccgaaccctggtcagcaacagctatatt
gaaggcgacgtcgatatcgtttccggtcgtggggcggtcgtgttcgataataccgacttc
cgtgtggtcaattcgcgcacccagaaagagggctacgtctttgcgccagcgaccctgaag
agcgtgacctacggcttcctggcgatcaacagccgctttaccgcttccggcgataacgtc
gcgcagctgggccgctctctggacgttgacggcaacaccaatggccaggtcgttattcgc
gatagcgtcattaatgaaggctttaatattgccaaaccgtgggctgatgccgtcggttca
aaccgtccgtttagcggcaacaccggtactgcggatgccaaaggcaacccgcagcgtaac
ctgaatgacgctaacttcaaccgcatgtgggaatacaacaaccgcggcgtgggaagcttt
gtcgtcgctgaaccgaagcagtaa

DBGET integrated database retrieval system