KEGG   Klebsiella oxytoca KCTC 1686: KOX_16445Help
Entry
KOX_16445         CDS       T01681                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KOX_16445
  Lipid metabolism
   00561 Glycerolipid metabolism
    KOX_16445
   00600 Sphingolipid metabolism
    KOX_16445
Enzymes [BR:kox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     KOX_16445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3569545..3570852)
Genome map
AA seq 435 aa AA seqDB search
MIKVTFMGAGSTIFARNVLGDIMTTPALKEVEIALYDIDSARLNESLAMLNNINRNTNAG
RAKIAAYLGVENRRAALKNANYVVNAIQVGGYDPCTITDFTIAKKYGLQQTIADTLGIGG
IFRALRTLPVLFDFARDIEAVCPDAWLLNYTNPMATITGAMLRHTEVKTVGLCHSVQVCA
ETLLKSVDMPTDDVQFHIAGINHMAWLLDIRRHGEDLYPEIKRRASALQGKHDDMVRHEI
MKTFGYYVTESSEHNAEYMPYWIKRSYPELIERFNIPLDEYPRRCIEQIDQWQQQKVALT
HDTSLTHSRTHEYASYIIEAMETDRPYKIGGNVLNTGLITNLPSEACVEVPCLVDGQGVT
PCYVGNLPEQLAALNRTNINTQLLTIEAAVTRKREAIYHAALLDPHTSAELSIDDIRNLC
DDLIEAHGSWLPAYH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtgacatttatgggcgcaggcagcaccattttcgccaggaacgtactcggc
gacattatgacgacgccggcgttgaaagaggtggagattgcgctgtacgacatcgacagc
gcccgtctcaatgaatccctcgccatgttgaataatatcaaccgcaataccaatgcgggc
agagcgaagatcgccgcttaccttggcgttgagaaccgccgcgcggcgttgaaaaacgcc
aattacgtggtgaatgctattcaggttggcggctacgatccgtgcaccatcaccgatttc
acgatcgcgaaaaaatatggtctgcagcagactattgccgataccctgggcattggcggt
atcttccgcgcgctgcgcaccctacccgtgctgtttgatttcgcacgggatattgaagcc
gtgtgcccggacgcctggctgctgaactacaccaacccgatggccacgataacaggcgcc
atgctgcgccatacggaagtgaaaacggtaggactgtgccacagcgttcaggtatgtgct
gaaacgctgttgaaaagcgtggatatgccaaccgacgacgtgcaatttcatatcgcgggt
attaatcacatggcctggctgctggacattcgccgtcacggcgaggatttgtacccggaa
atcaagcgccgggccagcgccctgcagggcaagcatgatgatatggtgcgccatgaaatc
atgaaaactttcggctattacgtcaccgaatcgtcagagcacaacgccgaatacatgcct
tactggatcaaacgcagctacccggagctgattgaacgcttcaatatcccgctggatgaa
tatccgcgccggtgtattgaacagattgaccaatggcagcagcagaaagtggcgctgacc
catgacaccagcctgacccacagccgtacccatgaatacgcgtcttacatcatcgaagcg
atggaaaccgatcggccttacaaaattggcggtaacgtgctcaacaccggcctgattacc
aacttaccttccgaggcctgcgtcgaagtcccttgcctggtcgatggccagggcgtcacg
ccgtgctacgtcggcaatttgccggagcagctggcagcgctgaaccggaccaacatcaat
actcagctgttgaccatcgaagcggcggtgacgcgcaaacgcgaagccatctaccatgcc
gccctgctcgacccgcatacttccgcagagctgtcgatcgatgacatccgcaatctgtgc
gacgatcttattgaagcacacggcagctggcttcccgcctaccattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system