KEGG   Klebsiella oxytoca KCTC 1686: KOX_17360Help
Entry
KOX_17360         CDS       T01681                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KOX_17360
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    KOX_17360
Enzymes [BR:kox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KOX_17360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3764108..3765130
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVEGFELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIREASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAAEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHDDPDKALAIARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETP
RDPRAEAEIRARDMAIFRTLIGEQRLDAIMPAHVIYSDVDPRPASGSAHWLKTVLRGELG
FEGVIFSDDLSMEGAAIMGSYAERGQASLEAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TKLYHKGSFSRQALRDSARWKTISAQLEQLHARWQEAKSA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccggtaatgttggatgtcgaaggttttgaactggatgcggaagagcgtgagatt
ctggcgcatcctttggttggcgggctgatcctgtttacccgcaactatcacgatccggcg
cagctgcgtgagctggtccgccagatccgcgaggcctcgcgcaaccatctggtggtggcg
gtagatcaggaaggcgggcgcgtacagcgtttccgcgagggctttacccgccttcccgcg
gcgcaatctttcgccgcgctgcttggcatggaggagggcggtaagctggccgcagaggcc
ggctggctcatggccagcgaaatgatcgccatggatattgatatcagctttgcgccggtt
ctggacgttgggcatatcagcgccgctattggcgagcgatcctatcacgacgatcccgac
aaagccctggcgatagctcgtcattttattgacggcatgcacgccgcgggaatgaaaacc
accggtaagcactttcccggacacggcgcggtgacggccgattcccataaagagacgccg
cgcgatccgcgcgcggaagcggaaattcgcgccagagatatggccatcttccgtacgctg
attggcgagcagcggcttgatgcgatcatgcccgctcacgtcatctacagcgacgttgac
ccgcgtccggccagcggatctgcgcactggctaaaaacggttctgcgcggtgagctggga
tttgaaggggtgattttctctgacgatctgtcgatggaaggggcggcgattatgggcagc
tacgccgagcgcggccaggcatcgctggaagcgggttgcgatatgatccttgtctgcaat
aatcgtaagggtgcggtcagcgtgctggataacctgtcgccgatcaaagcagaacgtgtt
acgaaattgtatcataaaggttcctttagccgtcaggcgttaagggattccgcccgctgg
aagacgatcagcgcgcagcttgagcagcttcacgcgcgctggcaagaggcgaaatccgcg
taa

DBGET integrated database retrieval system