KEGG   Klebsiella oxytoca KCTC 1686: KOX_17440Help
Entry
KOX_17440         CDS       T01681                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_17440 (tpiA)
   01230 Biosynthesis of amino acids
    KOX_17440 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_17440 (tpiA)
   00051 Fructose and mannose metabolism
    KOX_17440 (tpiA)
   00562 Inositol phosphate metabolism
    KOX_17440 (tpiA)
Enzymes [BR:kox01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KOX_17440 (tpiA)
Exosome [BR:kox04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KOX_17440 (tpiA)
  Exosomal proteins of bladder cancer cells
   KOX_17440 (tpiA)
  Exosomal proteins of melanoma cells
   KOX_17440 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3783102..3783896)
Genome map
AA seq 264 aa AA seqDB search
MEQIWLGTSWKMNKPLSQAMAFCETLAQRLPQVRHPKIQPFIIPPFTAIYPVSQYLQQHQ
IPCLTGAQNMHEAENGAWTGEISAAMLAETGAALVELGHSERRGAFNESDAAINQKVHRA
LRHGLRPLICIGDSADEKRWQVSRETVVRQMKIALYGLNEQQVLHTLVAYEPIWAIGEHG
TPATPEQAAEIHRALRQALCETFSEEIGRRVPLLYGGSVNRQNAVELLQQDDINGLFIGR
AAWDANGYCDIVQRVTEEFILQAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatctggttaggaaccagctggaaaatgaacaaaccgttatcgcaagccatg
gccttttgtgaaacgctggcgcagcggttaccgcaggtgaggcatccgaaaatccagccg
tttattattccccctttcaccgccatttatcccgtcagccagtatctacagcagcatcag
atcccctgcctgaccggcgcgcagaatatgcatgaagcggaaaacggcgcctggaccggt
gaaatatccgccgccatgctggctgaaaccggcgccgccctggtcgagcttggtcactcc
gagcgtcgcggcgcgttcaatgaatccgacgccgccattaaccaaaaagtacatcgcgcc
ctgcgtcatggccttcggcctctgatctgtatcggcgacagcgccgatgaaaaacgctgg
caggtctcacgggaaacggtagtgcggcagatgaaaatcgcgctttatggcctgaatgaa
cagcaggttttacacactctggttgcctatgagcccatatgggctatcggcgaacacggc
acgccggcgacgccggagcaggccgcagagatccaccgggcgctgcgtcaggcgttatgc
gagaccttcagcgaagaaatcggacggcgcgttcccctgctgtacggcggtagcgtcaat
cggcaaaatgccgtagaactccttcagcaggatgacattaacggactgtttattggccgc
gcggcatgggatgccaacggctattgcgacattgttcaacgcgttacagaggaatttatt
cttcaggcgcagtag

DBGET integrated database retrieval system