KEGG   Klebsiella michiganensis KCTC 1686: KOX_17980Help
Entry
KOX_17980         CDS       T01681                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00010  Glycolysis / Gluconeogenesis
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_17980
Enzymes [BR:kox01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     KOX_17980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEX05318
UniProt: A0A0H3HAA2
Position
complement(3892314..3893198)
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVIEQLTPVLSRRQLDDLELIVVDHPQVKASVAFQGAHLLSWKPAGEEEVLW
LSGNTPFKNGVALRGGVPICWPWFGPSALQGLPSHGFARNLPWALKGHDEDDNGVVLTFA
LKSSDATRQYWPHEFTLLARFKLGKTCEIELEAHGEFETTSALHTYFNVGDIAAVKVSGL
GDRYIDKVKNAEEGVLSNGTETFPDRTDRVYLNAETCSVIHDDALNRNIDVTHHHNSNVV
AWNPGPALSVSMGDMPDDGYKTFVCVETCCVTETQKASEEKPSRLTQTLRVVKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaatttttgccctcccggttatcgaacagcttacccctgtactttcccgc
cgccagcttgatgacctggagctgatcgtcgttgaccatccgcaggtgaaagcgtccgtg
gctttccagggcgctcacctgctctcctggaagcccgctggcgaagaagaagtcctgtgg
ctcagcggcaacaccccatttaaaaacggcgttgccctgcgcggcggcgtgccgatttgc
tggccgtggtttggtccttctgctctgcagggtctgccctcccacggcttcgcccgcaac
ctgccgtgggccctgaaagggcacgatgaagacgacaacggcgtggtgctgacctttgca
ctgaaaagcagcgacgccacccgccagtactggccgcacgagttcaccctgctggcgcgc
tttaagctgggcaaaacctgcgaaattgagctggaggcgcacggcgaatttgaaaccacg
tctgccctgcatacctatttcaacgtcggcgacattgcggcagtgaaggtcagcggtctg
ggcgaccgttatattgataaagtgaaaaatgcggaagaaggcgtattaagcaacggcaca
gagacttttcccgaccgtaccgaccgcgtctatctgaatgccgaaacctgcagcgtgatt
catgacgatgcgctgaaccgcaacatcgacgttacgcatcatcataacagcaacgttgtg
gcctggaacccgggcccggcgctttccgtcagcatgggcgacatgccggatgatggttac
aagaccttcgtttgtgtagaaacctgctgcgtgaccgaaacgcagaaggccagcgaagag
aaaccttcgcgcctgacgcaaaccctccgcgtggtgaaacgctaa

DBGET integrated database retrieval system