KEGG   Klebsiella oxytoca KCTC 1686: KOX_18325Help
Entry
KOX_18325         CDS       T01681                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KOX_18325 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KOX_18325 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KOX_18325 (trpA)
Enzymes [BR:kox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KOX_18325 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3962442..3963251)
Genome map
AA seq 269 aa AA seqDB search
MERYETLFAQLKARREGAFVPFVTLGDPNPEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQDATLRAFAAGVTPAQCFEMLTAIRQKHPTIPIGLLMYANLVFSPGIDEFYAACER
AGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLHHLIEKLAEYHAAPPLQGFGISAPEQVTAAIEAGAAGAISGSAIVKI
IERNVNDPQAMLAELKAFARSLKAATKAA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatgagacgctgtttgcacaactgaaagctcgccgggaaggcgcgtttgtt
cccttcgtcaccctcggcgatccgaatccggaacagtcgctgaaaattatcgatacgctg
attgaagccggtgccgacgcgctggagctgggcattcctttctccgacccgctggcggat
ggcccgaccattcaggacgccaccctgcgcgcttttgccgccggggtgacccccgcgcag
tgcttcgaaatgctgacggcgattcgccagaaacaccctaccattcctatcggcctgctg
atgtacgccaacctggtgttcagccccggcatcgatgaattctacgccgcgtgtgaacgc
gcgggcgtcgattccgtgctggttgccgatgttcccgtggaagagtccgcgccgttccgc
caggccgcgctgcgccacaatatcgcgccgattttcatctgcccgcccaatgccgatgac
gatctgctgcgccagatagcctcttacggtcgcggttatacttacctgctgtcgcgggcg
ggcgtgaccggcgcggaaaaccgcgccgcgctgccgctgcatcatctgattgaaaagctg
gccgagtaccacgccgcgccgccgctgcagggctttggcatctcggcgccggagcaggtt
accgccgcgattgaggccggcgcggccggcgcgatttccggctcagccatcgtcaaaatc
atcgaacggaacgtgaatgatccgcaggccatgctggcggaactcaaggctttcgcccga
agcctgaaagccgccactaaagcggcttaa

DBGET integrated database retrieval system