KEGG   Klebsiella michiganensis KCTC 1686: KOX_18330Help
Entry
KOX_18330         CDS       T01681                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00260  Glycine, serine and threonine metabolism
kox00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01130  Biosynthesis of antibiotics
kox01230  Biosynthesis of amino acids
Module
kox_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KOX_18330
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KOX_18330
Enzymes [BR:kox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KOX_18330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEX05388
UniProt: A0A0H3HAG8
Position
complement(3963251..3964444)
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTDLLKNYAGRPTALT
KCRNLTEGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGS
YEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIDETAVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTEEGQIEESYSI
SAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKELSRHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtactttactgaacccctactttggcgaattcggcgggatgtacgttccgcagatc
ctgatgcccgccctgcgccagctggaagaagccttcgtcagcgcgcaaaaagatccggca
ttccaggccgaatttaccgacctgctgaaaaactacgccggtcgtccgacggcgctgacc
aaatgccgcaacctcactgaaggcacccgcacgacgctgtatctgaaacgtgaagacctg
ctgcacggcggtgcgcataaaactaaccaggtgctcggccaggctctgctggcgaaacgg
atgggcaaaacggaaattatcgccgaaaccggcgccggtcagcacggcgtggcctctgcc
ctcgccagcgccctgctcggcctgaagtgccgcatctatatgggcgcgaaggatatcgaa
cgccagtcgccgaacgttttccgcatgcgcctgatgggggcggaagtgatcccggttcat
agcggctcttctacgctgaaagatgcctgcaacgaggccctgcgcgactggtccggcagc
tacgaaaaagcccactatatgctcggcaccgccgcgggtccgcacccgttcccgaccatt
gtgcgtgaattccagcgcatgattggcgaagagaccaaagcgcagatcctcgagaaagaa
ggtcgcctgccggatgcggttatcgcctgcgtcggcggcggatcgaacgctatcggcatg
ttcgccgattttatcgacgaaaccgctgttggcctgattggcgtggagccggcaggtcac
ggtattgagtccggcgagcacggcgcgccgcttaagcacggtcgtgtgggcatctacttc
ggtatgaaatcgccgatgatgcaaaccgaagaaggccagattgaggagtcctactccatc
tccgccgggctcgatttcccgtcagtcggcccgcagcatgcttatttaaacagcattggc
cgcgccgattacgtgtcgattaccgatgacgaagcgctggaggcctttaaagagctatca
cgccatgaagggattatcccggcgctggaatcctcccacgccctggcgcacgcgctgaaa
atgatgcgtgaaaacccggaaaaagagcagctgctggtggttaacctctccggccgcggc
gataaagacatcttcaccgtacatgatattttaaaagcgcgaggggaaatctga

DBGET integrated database retrieval system