KEGG   Klebsiella michiganensis KCTC 1686: KOX_19445Help
Entry
KOX_19445         CDS       T01681                                 

Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00071  Fatty acid degradation
kox00280  Valine, leucine and isoleucine degradation
kox00281  Geraniol degradation
kox00310  Lysine degradation
kox00360  Phenylalanine metabolism
kox00362  Benzoate degradation
kox00380  Tryptophan metabolism
kox00410  beta-Alanine metabolism
kox00627  Aminobenzoate degradation
kox00640  Propanoate metabolism
kox00650  Butanoate metabolism
kox00903  Limonene and pinene degradation
kox00930  Caprolactam degradation
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01212  Fatty acid metabolism
Module
kox_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KOX_19445
   00650 Butanoate metabolism
    KOX_19445
  Lipid metabolism
   00071 Fatty acid degradation
    KOX_19445
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KOX_19445
   00310 Lysine degradation
    KOX_19445
   00360 Phenylalanine metabolism
    KOX_19445
   00380 Tryptophan metabolism
    KOX_19445
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KOX_19445
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KOX_19445
   00281 Geraniol degradation
    KOX_19445
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KOX_19445
   00627 Aminobenzoate degradation
    KOX_19445
   00930 Caprolactam degradation
    KOX_19445
Enzymes [BR:kox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KOX_19445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEX05611
UniProt: A0A0H3HGG1
Position
4203887..4204654
Genome map
AA seq 255 aa AA seqDB search
MSELFIARHARVLQLTLNRPQARNALNNALLTQIADVLDAAALDPSVGVCVISGNERFFA
AGADLNEMAEKDLPATLDDIRPRLWARIDAFSKPLIASVNGYALGAGCELALLCDLIVAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKALASRMVLSGESIDAHQAQRAGLVCEVYPP
ALTDEYALALAATVARHSPLALRAAKQALRLSQEVSLQAGLQQERQLFTLLSATEDRREG
IDAFLHKRTAEFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgttcattgctcgtcacgcgcgcgtactgcagctgacgctaaatcgcccg
caggcgcgcaacgctttgaataacgcgctgctgacgcagatcgccgacgtgctcgacgcg
gcggcgctggacccgtcggtcggcgtctgcgtcatcagcggtaacgaacgcttctttgcc
gcaggggctgacctgaacgaaatggcggaaaaagatctgcccgccacgctcgatgatatt
cgcccgcggctgtgggcgcgtatcgacgccttcagtaaaccgctgatcgcttcggttaac
ggctatgccctcggcgccggatgcgagctggcgctgctctgcgatctgatcgtcgctggc
gataacgcccgcttcggcctgccggaaatcaccctcggcattatgccgggcgcgggcggg
acccagcgcctgatccgctccgtcggtaaggcgctggccagccggatggtcttgagcggc
gaaagcattgatgcccatcaggcgcagcgggcggggctggtatgcgaggtttatccgcca
gcgctcaccgatgaatatgcactcgctttggcggcaaccgtggctcgccactcgccgctg
gcgctgcgcgcggctaagcaggctttgcggttgtcgcaggaggtgagcctgcaggccggg
cttcagcaggagcgccagctgtttactttgctgagcgcgaccgaagatcgccgcgaaggc
atcgacgcctttttacataaacgtactgcggaatttaaaggacgctaa

DBGET integrated database retrieval system