KEGG   Klebsiella oxytoca KCTC 1686: KOX_19780Help
Entry
KOX_19780         CDS       T01681                                 

Definition
acyl-CoA thioesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KOX_19780
   00500 Starch and sucrose metabolism
    KOX_19780
Enzymes [BR:kox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     KOX_19780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4273252..4274538
Genome map
AA seq 428 aa AA seqDB search
MISFIHGEREMRKITILGISALLFTPLLLQGCATQTPRGTTSRPQLTAAEAATFTIERYF
AQGGALNDPDGPWSPSPVHLPQTESAWRVAPSGAPFTRIQQAVNAAIGQHGAQEARIYIR
IEPGIYRETVYIPEGAPPITLYGAGDSPEEVRIELAIDSQFSVARYRQRVNSQQQYREGD
PAWYQYALCAGRTSKTIGTNCAAVVWSQSADFQLLNLSVANSLLDTVDGGTHQGVALRTD
GDRVQLENVRLLGRQDTLYVNTSNRRNEAVTDRISRVYVKDSYVEGDVDYVFGRANAVFD
NVHFHTVSTRRSPEAYVLAPNTLPDNPYGFLVKNSRFTGDGGYQGSFKAKLGRAWDQGAG
KTGYLAGKTANGQVLIANSIIDQSYDRLSPWDAAATTARPFRGNTSAERQLDDVAFNRLW
EFNNHWQP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatttcttttattcatggcgagcgtgaaatgcgaaaaatcactatcctgggtatctcg
gctttactctttacaccgctgcttctgcaagggtgcgcgacgcaaactccccgcgggacg
acctcccgtccacagcttacggcggcagaagcggcaaccttcaccattgagcgctatttt
gcgcaaggcggcgcgttaaatgaccccgatggcccctggtcgccatcgccggttcacctc
ccgcaaaccgagagcgcgtggcgcgtggcaccctcgggagcgccgttcacccgcattcag
caggcggttaacgcggcaataggccagcatggggcgcaggaggcgcgcatctatatccgc
atcgaaccgggcatctatcgggagacggtctatatccctgaaggcgcgccgccgataacc
ctctacggcgccggagatagtcctgaagaggtgagaattgagctggcaatagactcgcag
ttctcggtagcgcgctatcgccagcgggtaaatagccaacagcaataccgcgaaggcgat
ccggcatggtatcagtatgcgctgtgcgccgggcgaaccagcaagacgataggcaccaac
tgcgcggcggtggtctggtcgcaaagtgcggattttcagctgctgaatctcagcgtagcc
aatagcctgctggataccgtcgacggtgggacgcatcagggcgtggcgctgcggacggac
ggcgatcgcgtgcagctggagaacgtccgcctgctcggacgtcaggacacgctctacgta
aataccagcaatcggcgcaatgaggcggtaaccgaccgtatcagccgggtatacgtgaaa
gacagctacgtcgaaggggatgtggactacgtctttggccgggcgaacgccgtttttgat
aacgtccattttcacaccgtctcaacgcgccgctcgcctgaggcatacgtgcttgcgccg
aatacgttgccggataatccatacggctttctggtgaagaatagccgctttaccggcgac
ggcggctatcagggcagcttcaaggcgaagctgggccgcgcctgggatcagggggcgggg
aagaccggttatttagcgggtaaaaccgctaacgggcaggtgcttattgccaacagtatt
atcgatcaaagctacgatcggctttccccctgggacgctgcggccaccaccgcccggccg
ttccgcggcaacacttccgcagaacggcagcttgatgatgttgccttcaatcgcctgtgg
gaattcaataaccactggcagccctga

DBGET integrated database retrieval system