KEGG   Klebsiella michiganensis KCTC 1686: KOX_20090Help
Entry
KOX_20090         CDS       T01681                                 

Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00010  Glycolysis / Gluconeogenesis
kox00071  Fatty acid degradation
kox00350  Tyrosine metabolism
kox00625  Chloroalkane and chloroalkene degradation
kox00626  Naphthalene degradation
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_20090
  Lipid metabolism
   00071 Fatty acid degradation
    KOX_20090
  Amino acid metabolism
   00350 Tyrosine metabolism
    KOX_20090
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KOX_20090
   00626 Naphthalene degradation
    KOX_20090
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KOX_20090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEX05740
UniProt: A0A0H3HBB1
Position
complement(4342258..4343268)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVNVTEKTLRPLQHGEALLKMDCCGVCHTDLHVKNGDFGDKTGVILGHEG
VGVVQQVGPGVHSLKPGDRASVAWFFEGCGHCEYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVMADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIALDVNDEQLKLAAEMGADLTINSRSEDAAKIIHEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVTLRPLGDINAIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgtcacgcaagatcatcaggtcaatgttacggaaaaaacgcttcgt
cccctgcaacatggcgaagcccttttaaaaatggattgctgcggcgtatgtcacaccgac
ctgcacgttaagaacggcgactttggcgataaaaccggggtcattctgggccatgaaggc
gtgggcgttgtgcagcaggtcggccccggcgttcattctctgaagccgggcgatcgcgcc
agcgtggcgtggttcttcgaaggctgcgggcattgtgaatattgtaacagcggcaacgaa
acgctgtgtcgctcggtgaaaaatgccggctataccgtggatggcggtatggcggaagag
tgtatcgtcatggccgactacgcggtcaaagtgccggacgggctcgattctgcggcggcc
agcagcatcacctgcgcgggcgtcaccacctataaagcggtcaaagtctcacatatcaaa
cccggccagtggattgccatttatggcctcggcggcctcggcaatctggcgctgcagtat
gccaaaaacgtgtttaacgccaaagtcatcgcccttgacgttaatgatgaacagctgaag
ctggccgcggaaatgggcgcggacctgaccatcaactcccgcagcgaagacgcagccaaa
attattcatgagaaaaccggcggcgcgcatgccgcggtggtaaccgccgtcgccaaagcg
gcgtttaactcagcggtggatgcggttcgcgcgggtggacgcgtggtggcggtaggcctg
cctccggaagcgatgagcctggacattccgcgtctggtcctcgacggtatcgaagtggtg
ggttcgctggtcggtacccgtcaggacctgaccgaagccttccagtttgccgcggaaggg
aaagtcgtaccgaaagtgaccctgcgtccgctgggcgatatcaacgccatcttcaaagag
atggaacagggacagattcgcggccgtatggtcattgatttccgccgctaa

DBGET integrated database retrieval system