KEGG   Klebsiella oxytoca KCTC 1686: KOX_20090Help
Entry
KOX_20090         CDS       T01681                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KOX_20090
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_20090
  Lipid metabolism
   00071 Fatty acid degradation
    KOX_20090
  Amino acid metabolism
   00350 Tyrosine metabolism
    KOX_20090
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KOX_20090
   00626 Naphthalene degradation
    KOX_20090
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KOX_20090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4342258..4343268)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVNVTEKTLRPLQHGEALLKMDCCGVCHTDLHVKNGDFGDKTGVILGHEG
VGVVQQVGPGVHSLKPGDRASVAWFFEGCGHCEYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVMADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIALDVNDEQLKLAAEMGADLTINSRSEDAAKIIHEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVTLRPLGDINAIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgtcacgcaagatcatcaggtcaatgttacggaaaaaacgcttcgt
cccctgcaacatggcgaagcccttttaaaaatggattgctgcggcgtatgtcacaccgac
ctgcacgttaagaacggcgactttggcgataaaaccggggtcattctgggccatgaaggc
gtgggcgttgtgcagcaggtcggccccggcgttcattctctgaagccgggcgatcgcgcc
agcgtggcgtggttcttcgaaggctgcgggcattgtgaatattgtaacagcggcaacgaa
acgctgtgtcgctcggtgaaaaatgccggctataccgtggatggcggtatggcggaagag
tgtatcgtcatggccgactacgcggtcaaagtgccggacgggctcgattctgcggcggcc
agcagcatcacctgcgcgggcgtcaccacctataaagcggtcaaagtctcacatatcaaa
cccggccagtggattgccatttatggcctcggcggcctcggcaatctggcgctgcagtat
gccaaaaacgtgtttaacgccaaagtcatcgcccttgacgttaatgatgaacagctgaag
ctggccgcggaaatgggcgcggacctgaccatcaactcccgcagcgaagacgcagccaaa
attattcatgagaaaaccggcggcgcgcatgccgcggtggtaaccgccgtcgccaaagcg
gcgtttaactcagcggtggatgcggttcgcgcgggtggacgcgtggtggcggtaggcctg
cctccggaagcgatgagcctggacattccgcgtctggtcctcgacggtatcgaagtggtg
ggttcgctggtcggtacccgtcaggacctgaccgaagccttccagtttgccgcggaaggg
aaagtcgtaccgaaagtgaccctgcgtccgctgggcgatatcaacgccatcttcaaagag
atggaacagggacagattcgcggccgtatggtcattgatttccgccgctaa

DBGET integrated database retrieval system