KEGG   Klebsiella michiganensis KCTC 1686: KOX_20740Help
Entry
KOX_20740         CDS       T01681                                 

Definition
(GenBank) putative acetylornithine deacetylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00300  Lysine biosynthesis
kox01100  Metabolic pathways
kox01120  Microbial metabolism in diverse environments
kox01230  Biosynthesis of amino acids
Module
kox_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    KOX_20740
Enzymes [BR:kox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KOX_20740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEX05868
UniProt: A0A0H3HEC2
Position
4493745..4494857
Genome map
AA seq 370 aa AA seqDB search
MAAPLELARQLLGFNTINPPGSEADCMRFFADWLNDRGFAVSLSSFGEGRCNLIARLPGA
KTGKPLAFTGHLDTVPLGNALWQYDPFGSQIEDGRLYGRGSSDMKAAIAAFAVACVHQRE
TILAGRGAVLLITGGEETGCDGARALIASATLPDVGALIVGEPTANYPAIGHKGALWLRC
ETRGKTAHGAMPELGINAIYLAADALGKIQHFSPGAAHPLMKQPTLNVGRIEGGLNINSV
PDRTLFDVDIRSAPNLQHATIRQRLTTLLGESVTVSTLVDLPAVLSREDHAWIKQVYQRC
QPLHAKPIEPRVVPYFTDASLLLPALGDPPCIILGPGEPSMAHQTDEYCLLSRLEEAEQL
YGDIIRDWMA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccccttgagctcgcccggcagctgctgggctttaacaccatcaacccgccg
ggcagcgaagcagactgcatgcggttcttcgccgactggctcaacgatcgcggttttgcg
gtttcgctgtcgtcgttcggcgagggacgctgcaatcttatcgccaggctgcccggggcg
aagaccggtaaaccgctggcctttaccggtcatctggataccgtgccgctgggaaatgcc
ctgtggcagtacgatcctttcggctcgcagatagaagacgggcgtctttatggccgcggg
tccagcgatatgaaagcggcgatagcggcgtttgccgtcgcctgcgttcatcagcgggaa
acgatcctcgccggacgcggcgcggtattgctgattaccggcggagaagagaccggctgc
gacggcgcacgggcgctgatcgcctccgcgacgttgccggacgtgggcgcgctgatcgtc
ggtgagcccaccgccaactatccggcgatcggccataaaggcgcgctctggctacgctgc
gaaacgcggggaaaaaccgcccacggcgcgatgccggagctggggataaatgctatctat
cttgcggcggatgcgctgggtaagattcagcatttttcccctggcgcggcgcacccgctg
atgaagcagcccaccctcaacgtcggacgcatcgaaggcggactcaatattaattccgtg
ccggaccgcacgctttttgatgtcgatatccgcagcgcgcccaatttacagcacgccact
atccggcagcgcttgaccacgctgcttggcgaaagcgtcacggtatccacgctggtcgac
ctgcccgccgtactgagccgggaggatcatgcgtggattaagcaggtttatcagcgctgc
cagccgctgcacgctaagccgattgaaccgcgcgtggtgccctactttaccgacgcctcg
ctgctgctgcctgcgttgggcgatccaccctgtattattctcggtcccggcgagccgtct
atggcccatcagaccgacgagtactgcctgctcagccggctggaggaggctgagcagcta
tacggagacattatccgcgactggatggcgtag

DBGET integrated database retrieval system