KEGG   Klebsiella oxytoca KCTC 1686: KOX_21840Help
Entry
KOX_21840         CDS       T01681                                 

Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KOX_21840
   00670 One carbon pool by folate
    KOX_21840
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     KOX_21840
    1.5.1.-  
     KOX_21840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4708934..4709659
Genome map
AA seq 241 aa AA seqDB search
MADIQPRPILITGGGRRIGLALARHFLARQQPVIISYRTWYPAVDALREAGAVCLHADFS
TDDSILAFAEEVKAHAGSGLRAIIHNASGWMAEKPGVPLTTVLASMMQIHVNAPYLLNHA
LESLLRGHGHAASDIIHITDYVVERGSDKHIAYAASKAALDNMSRSFARKLAPEIKVNAI
APSLILFNEGDDAEYRKQALDKSLMKIAPGEKEISDLIEYLFSSRYVTGRSFAVDGGRNL
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgatatccagcctcgtccaatcctgattaccggcgggggccgtcgtatcggcctc
gccctggcccgccattttctggcccggcagcagcccgttattatcagctaccgcacctgg
tatcccgccgtcgacgcgcttcgtgaagcgggcgccgtttgtctgcacgcggatttcagc
actgacgatagcattctggcgttcgccgaagaggtgaaggcgcacgccggcagcggtctg
cgcgccatcatccataacgccagcggctggatggcggaaaagcccggggtgccgttaacc
acggtgctcgccagcatgatgcaaattcacgtcaacgccccctacttgctcaaccatgct
ctggagagcctgcttcgcggccacggccatgcggccagcgacattatccatatcaccgac
tacgttgtggagcgcggcagcgacaaacacattgcctacgccgccagcaaagcggcgctg
gataatatgagccgctcgttcgcccgcaagctggcgccggaaattaaggtcaatgctatc
gccccttcgctgattttatttaacgaaggcgatgacgcggaataccgcaagcaggcgctt
gataaatcgctgatgaaaatcgcgccaggtgaaaaagagatcagcgacctgatcgaatac
ctgttcagcagccgctacgtgaccggtcgctcatttgccgtcgacggcggccgcaatctg
cgctag

DBGET integrated database retrieval system