KEGG   Klebsiella oxytoca KCTC 1686: KOX_21840Help
Entry
KOX_21840         CDS       T01681                                 

Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kox00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:kox00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4708934..4709659
Genome map
AA seq 241 aa AA seqDB search
MADIQPRPILITGGGRRIGLALARHFLARQQPVIISYRTWYPAVDALREAGAVCLHADFS
TDDSILAFAEEVKAHAGSGLRAIIHNASGWMAEKPGVPLTTVLASMMQIHVNAPYLLNHA
LESLLRGHGHAASDIIHITDYVVERGSDKHIAYAASKAALDNMSRSFARKLAPEIKVNAI
APSLILFNEGDDAEYRKQALDKSLMKIAPGEKEISDLIEYLFSSRYVTGRSFAVDGGRNL
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgatatccagcctcgtccaatcctgattaccggcgggggccgtcgtatcggcctc
gccctggcccgccattttctggcccggcagcagcccgttattatcagctaccgcacctgg
tatcccgccgtcgacgcgcttcgtgaagcgggcgccgtttgtctgcacgcggatttcagc
actgacgatagcattctggcgttcgccgaagaggtgaaggcgcacgccggcagcggtctg
cgcgccatcatccataacgccagcggctggatggcggaaaagcccggggtgccgttaacc
acggtgctcgccagcatgatgcaaattcacgtcaacgccccctacttgctcaaccatgct
ctggagagcctgcttcgcggccacggccatgcggccagcgacattatccatatcaccgac
tacgttgtggagcgcggcagcgacaaacacattgcctacgccgccagcaaagcggcgctg
gataatatgagccgctcgttcgcccgcaagctggcgccggaaattaaggtcaatgctatc
gccccttcgctgattttatttaacgaaggcgatgacgcggaataccgcaagcaggcgctt
gataaatcgctgatgaaaatcgcgccaggtgaaaaagagatcagcgacctgatcgaatac
ctgttcagcagccgctacgtgaccggtcgctcatttgccgtcgacggcggccgcaatctg
cgctag

DBGET integrated database retrieval system