KEGG   Klebsiella oxytoca KCTC 1686: KOX_21870Help
Entry
KOX_21870         CDS       T01681                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    KOX_21870
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KOX_21870
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KOX_21870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4714604..4715071
Genome map
AA seq 155 aa AA seqDB search
MTTFYQLTATSLHGQPISMADYAGKLVLVVNTASQQYAGLEALYAKYAAHGLIVLGFPCN
QFGKQEPGGVDDIEQTCRINYGVSFPMFEKVEVNGAGAHPLFRYLKDELPGVLGGRIKWN
FTKFLIGRDGTPLTRFAPFTTPEKMETAILAALKI
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgactaccttttaccaattgactgccaccagcctgcacggccagcccatctcaatggct
gactatgctggcaagctcgttctggtggtcaatactgccagccagcaatatgcagggctg
gaagcgctctatgcgaaatacgctgcccatgggctgatagtgcttggtttcccctgcaac
cagtttggtaagcaggagcccggcggcgtcgatgacatcgagcagacctgtcggatcaat
tacggtgtaagcttcccgatgttcgagaaagtggaggtcaacggcgccggcgcgcacccg
ctgtttcgttacctgaaagatgagttacccggcgtgctgggcgggcggatcaaatggaac
ttcacgaagttcttgatcggtcgcgacggcacccctctcacgcgtttcgcgccgttcacc
accccggagaaaatggagaccgccatccttgccgcactaaagatttaa

DBGET integrated database retrieval system