KEGG   Klebsiella michiganensis KCTC 1686: KOX_22675Help
Entry
KOX_22675         CDS       T01681                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00360  Phenylalanine metabolism
kox00362  Benzoate degradation
kox00620  Pyruvate metabolism
kox00621  Dioxin degradation
kox00622  Xylene degradation
kox00650  Butanoate metabolism
kox01100  Metabolic pathways
kox01120  Microbial metabolism in diverse environments
kox01220  Degradation of aromatic compounds
Module
kox_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KOX_22675
   00650 Butanoate metabolism
    KOX_22675
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KOX_22675
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KOX_22675
   00622 Xylene degradation
    KOX_22675
   00621 Dioxin degradation
    KOX_22675
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KOX_22675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA NAD_binding_3 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AEX06253
UniProt: A0A0H3HFK7
Position
complement(4883829..4884779)
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPESDGLARARRMGVATTHEGVG
GLMQMAEFADIDVVFDATSAGAHVKNDAALREARPGIRVIDLTPAAIGPYCVPVVNLEAN
LAEGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASIASKSAGPGTRANIDEFTETTSQ
AIEKVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSEAASQQAIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDKPVNLPGVGRFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEKMAQAMNDAAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgtaaagtcgccattatcggctccggcaatatcggcaccgatttaatgatc
aaaattctgcgccacgggcagcacctggagatggcggtaatggtcggcatcgaccctgag
tccgacggcctggcccgcgcccggcgcatgggcgtcgccaccacgcacgagggcgttggc
ggcctgatgcagatggcggaattcgccgatatcgatgtggtttttgacgccaccagcgcc
ggagcgcacgtgaaaaacgacgccgcgctgcgggaagccaggccggggatccgggtgatc
gacctgaccccggcggccatcggcccgtactgcgtgccggtggtcaatctcgaggccaat
ctggccgaaggcaacgtcaatatggtgacctgcggcggccaggccaccatcccgatggtg
gcggcggtctcccgggtggcaaaagtgcactatgcggagatcatcgcctcgattgccagc
aaatccgccgggccggggacgcgcgccaacattgatgaatttaccgaaaccacctcgcag
gccattgagaaagtgggcggcgcggcgaaaggcaaagcgattatcgtgctgaatccggcg
gagccgccgctgatgatgcgcgacaccgtttatgtcctgagcgaagcggcatcgcagcag
gcgattgccgcgtcgatcgccgagatggcggcggcggtacaggcctacgtgccgggatat
cgcctgaagcagcaggtgcagtttgaggtcatcccggaagataaaccggtaaacctgccg
ggcgtcggccgcttctccggcctgaaaacggcggtttatctcgaggtcgaaggggcggcg
cactatctgccagcctacgcgggtaacctcgatattatgacgtcggcggcgctggcgacg
gcggaaaaaatggcccaggcgatgaacgacgcggcgggagaagcagcatga

DBGET integrated database retrieval system