KEGG   Klebsiella michiganensis KCTC 1686: KOX_22945Help
Entry
KOX_22945         CDS       T01681                                 

Definition
(GenBank) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00010  Glycolysis / Gluconeogenesis
kox00030  Pentose phosphate pathway
kox00051  Fructose and mannose metabolism
kox00052  Galactose metabolism
kox00680  Methane metabolism
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01200  Carbon metabolism
kox01230  Biosynthesis of amino acids
Module
kox_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_22945
   00030 Pentose phosphate pathway
    KOX_22945
   00051 Fructose and mannose metabolism
    KOX_22945
   00052 Galactose metabolism
    KOX_22945
  Energy metabolism
   00680 Methane metabolism
    KOX_22945
Enzymes [BR:kox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KOX_22945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AEX06307
UniProt: A0A0H3HAK7
Position
4941855..4942784
Genome map
AA seq 309 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAITFLGGSATAIFP
VGGATGEHLTALLTDEHVPVDTVETHDWTRQNLHVHVNASGEQYRFVMPGAALTKEELRL
LEEKVLAIAPGSLLVISGSLPPGISVDNLTQLVKNAQQHGLRCIVDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRLAAQELIRSGKVQRVVVSLGAQGALGVDAQGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAENASLEDMVRFGVAAGSAATINQGTRLCSLDNT
QKIYNYLRG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatctatacgctcacgttagccccctcgctcgatagcgcaacccagaccccg
caaatttacccggaaggcaaactgcgctgtagcgctcccgtgtttgaacccggcggcggc
ggaattaacgttgcgcgagccatcacttttcttggcggcagcgccacagccatctttccc
gtcggcggggcgacaggcgaacacctgacggcgctgctgacggatgaacatgttcccgtc
gatacggtagagacccatgactggacgcggcagaatcttcacgtgcatgtgaacgccagc
ggcgagcaatatcgtttcgtgatgccgggcgcagcgttaactaaggaggagctccggctc
cttgaggaaaaggtcctcgccatcgccccgggttccctgctggtgattagcggaagtctc
ccgcccggcatcagcgtcgataacctgacgcagctggtcaaaaacgctcagcagcatgga
ttgcgctgtattgttgatagttccggtgacgcgctcgccgcagcgcttgatgtcggcaat
atcgagctggttaagccgaaccagaaagagcttagcgcgctggtacagcgcgatctgagc
cagccggatgatgtgcgtcttgcggcgcaggagctcattcggtcgggcaaagtccagcgc
gtcgtcgtctccctcggtgcccagggtgcgctcggcgttgatgcccagggtagcgttcag
gtggtaccgccgccgatgaaaagccagagcaccgtcggcgccggtgacagtatggtcggc
gcaatgaccttaaggctggcggaaaacgcctcgcttgaagatatggttcgctttggcgtt
gcggcgggtagtgcggcaaccatcaatcagggcacccgcctttgctcgctggataatacg
caaaaaatctacaactatctgcgcggttga

DBGET integrated database retrieval system