KEGG   Klebsiella oxytoca KCTC 1686: KOX_24135Help
Entry
KOX_24135         CDS       T01681                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:kox00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5201136..5202122)
Genome map
AA seq 328 aa AA seqDB search
MSLQNLTLFPRLELIGAPTPLEYLPRLSDYLGREIFIKRDDVTPLAMGGNKLRKLEFLAA
EALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPMGTRAENYLTNGNRLLLD
LFNTQVEMCDALTDPNAQLEALATRIEAQGYRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVELSSVVVASGSAGTHAGLAVGLEQLMPNAELIGVTVSRSVADQLPKVAALQQAVAN
SLELEAKAGIQLWDEYFAPGYGIPNDEEMAAVKLLAQLEGILLDPVYTGKAMAGLIDGIS
QKRFKDEGPILFVHTGGAPALFAYHPHI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaaaatttaaccctattcccgcgtctggaactgattggcgcgccgacgccg
ctggaatatctgccgcgcttgtccgattaccttggccgcgaaatttttatcaagcgcgat
gatgtgaccccgcttgcgatggggggcaacaagctacgtaagcttgaatttctggctgcc
gaagcgctgcgagaaggggcggataccctgattaccgccggagctatccagtccaaccat
gtgcgccagacggcggcggtggcggctaagctgggcctgcactgcgtggcgctactggag
aatccaatgggtacccgggctgagaactacctgaccaacggtaaccgcctgctgcttgac
ctgtttaatactcaggtcgaaatgtgcgacgcgctgaccgatcctaatgctcagctggaa
gcgctggcgacccgcattgaagctcagggctatcgtccgtacgtgattccggttggcggt
tcgaacgcgctgggcgcgctgggctatgtggagagcgcgctggaaattgcccagcagtgc
gaaggggcggtcgagctctcctccgtggtcgtcgcctccggcagcgccggtacgcatgcc
ggcctcgccgtgggactggagcagctgatgcccaatgccgagcttatcggcgtgaccgta
tcgcgcagcgtggctgaccagctgccaaaagtggctgcgctgcagcaggcggtggcaaat
agtctggaactggaggcaaaggccggtattcagctgtgggatgagtactttgcgccgggt
tacggaataccgaacgacgaagagatggcggcggtgaagctgctggcgcagctggaaggt
atcctgctggatccggtgtataccgggaaggcgatggccggattgattgatggtatcagc
cagaagcgctttaaggatgaaggcccaatactgtttgttcacaccggcggcgcgcctgcg
ctgttcgcctatcatcctcatatctaa

DBGET integrated database retrieval system