KEGG   Klebsiella michiganensis KCTC 1686: KOX_25035Help
Entry
KOX_25035         CDS       T01681                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00340  Histidine metabolism
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01230  Biosynthesis of amino acids
Module
kox_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    KOX_25035 (hisD)
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     KOX_25035 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEX06722
UniProt: A0A0H3HBW5
Position
5390405..5391709
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIYWNGCSAEQQQQLLTRPAISASESISKTVSEILNNVKDNGDAALREYGAKFDK
TDVKALKVSDEEIAAAGARLSDELKQAMAVAVKNIETFHNAQRLQAVDVETLPGVRCQQV
TRPIASVGLYIPGGSAPLFSTVLMLATPARIAGCQQVVLCSPPPIADEILYAAQLCGVRN
IFNVGGAQAIAALAFGTESVAKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDSEMATRVAQAVERQLAALSRAETARG
ALSASRIIVARDIAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSRDGFAALASTIEILAAAERLDAHK
NAVTLRVAALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaacacaattatctactggaacggctgtagcgcagaacaacagcaacagctc
ttaacgcgcccggccatttccgcctccgagagcatcagcaagacggtgtcggagatcctg
aataacgttaaagacaacggcgatgcggccctgcgcgaatacggcgcgaagttcgataaa
accgacgtcaaggcgctgaaggtcagcgatgaagagattgccgccgccggcgcgcgcctg
agcgacgagctcaagcaggcgatggccgtggcggtcaaaaatatcgaaaccttccacaac
gcgcagcggctgcaggccgtcgatgtggaaaccctgccgggcgtacgctgccagcaggtg
acccgccctatcgcctccgtcggcttatatattcccggcggctcggcgccgctgttctcc
acggtgctgatgctcgccacgccggcgcgcatcgcgggctgccagcaggtggtgctgtgt
tcgccgccgccgattgccgatgaaatcctctatgccgcccagctgtgcggcgtgcgcaat
atctttaacgtcggcggcgcgcaggcgattgccgccctggcgttcggcaccgaatcggta
gcgaaggtcgataaaatctttggcccgggcaacgccttcgtgaccgaagccaagcgccag
gtcagccagcgtcttgacggcgcggctatcgatatgcccgccgggccgtcggaagtgctg
gtgatcgccgacagcggtgccaccccggatttcgtcgcctctgacctgctttcccaggcg
gagcacggcccggattcgcaggtgatcctgctgacgccggatagcgagatggccacccgc
gtcgcgcaagccgttgagcgccagctggccgcgctatcccgtgcggaaacggcccgcggg
gcgctctccgccagccgcatcatcgtggcgcgcgatatcgcccagtgcgtggagatttcc
aaccagtacggtcccgagcacctgattattcagacccgcaacgcccgcgaactggtcgac
ggcattaccagcgccggttcggtatttctcggcgactggtcgccggaatccgccggcgat
tacgcctccggcaccaaccacgtgctgccgacctacggctacaccgccacctgctccagc
ctcggcctggcggattttcagaaacgtatgaccgtgcaggagctgtcgcgcgacgggttt
gccgccctcgcctcaacgattgagattctggccgccgccgagcgtctggacgcccacaaa
aacgccgttacgctgcgcgtcgcagcccttaaggagcaagcatga

DBGET integrated database retrieval system