KEGG   Klebsiella oxytoca KCTC 1686: KOX_26835Help
Entry
KOX_26835         CDS       T01681                                 

Definition
(RefSeq) cysteine synthase A
  KO
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_26835
   01230 Biosynthesis of amino acids
    KOX_26835
  Energy metabolism
   00920 Sulfur metabolism
    KOX_26835
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KOX_26835
Enzymes [BR:kox01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     KOX_26835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5797418..5798389
Genome map
AA seq 323 aa AA seqDB search
MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLK
PGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGM
KGAIQKAEEIVASNPEKFLLLQQFSNPANPEIHEKTTGPEIWEDTDGQIDIFISGVGTGG
TLTGVSRYIKGTKGKKDLITVAVEPTDSPVIAQALAGEELKPGPHKIQGIGAGFIPGNLD
LKLVDKVVAITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDEAFTNKNIVVILP
SSGERYLSTALFADLFTEKELQQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatttttgaagataactccctgactatcggccatacgccgctggtacgactg
aaccgcatcggtaacggacgcatcctggcaaaggtagaatctcgtaacccgagctttagc
gtaaaatgccgtatcggtgccaatatgatttgggatgccgaaaaacgcggcgtgctgaag
cccggcgttgagctggtggaaccgaccagcggtaataccggtatcgcgctggcctacgtg
gctgcggcgcgcggttataaactgacgctgacgatgccggagaccatgagcatcgaacgc
cgcaagctgctgaaggccctgggcgctaacctggtgctgaccgaaggcgccaaggggatg
aaaggcgccatccagaaagccgaagaaattgtcgccagcaacccggaaaaattcctcctg
ctccagcagttcagcaacccggccaacccggaaattcatgaaaaaaccaccggcccggaa
atctgggaagataccgatggtcaaatcgacatcttcatctccggcgtcggtactggcggt
acgctgaccggcgtgagccgctatatcaaaggcaccaaaggtaaaaaagatctgattacc
gttgccgttgaacctaccgactccccggttatcgcccaggcgctggcaggcgaagagctg
aagccaggcccgcacaaaatccagggtattggcgcaggctttatcccaggcaacctggat
ttgaagctggtggataaagtagtggctattaccaatgaagaagccatttccaccgcccgt
cgcctgatggaagaggaaggcattctggccggcatctcttccggcgctgccgttgccgct
gcgctgaagctgcaggaggatgaagcctttaccaacaagaatattgtggttatcctaccc
tcttcaggtgagcgctatttaagcaccgcattgtttgccgatctcttcaccgagaaagaa
ctgcaacagtaa

DBGET integrated database retrieval system