KEGG   Klebsiella oxytoca KCTC 1686: KOX_26835Help
Entry
KOX_26835         CDS       T01681                                 

Definition
cysteine synthase A
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_26835
   01230 Biosynthesis of amino acids
    KOX_26835
  Energy metabolism
   00920 Sulfur metabolism
    KOX_26835
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KOX_26835
Enzymes [BR:kox01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     KOX_26835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5797418..5798389
Genome map
AA seq 323 aa AA seqDB search
MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLK
PGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGM
KGAIQKAEEIVASNPEKFLLLQQFSNPANPEIHEKTTGPEIWEDTDGQIDIFISGVGTGG
TLTGVSRYIKGTKGKKDLITVAVEPTDSPVIAQALAGEELKPGPHKIQGIGAGFIPGNLD
LKLVDKVVAITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDEAFTNKNIVVILP
SSGERYLSTALFADLFTEKELQQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatttttgaagataactccctgactatcggccatacgccgctggtacgactg
aaccgcatcggtaacggacgcatcctggcaaaggtagaatctcgtaacccgagctttagc
gtaaaatgccgtatcggtgccaatatgatttgggatgccgaaaaacgcggcgtgctgaag
cccggcgttgagctggtggaaccgaccagcggtaataccggtatcgcgctggcctacgtg
gctgcggcgcgcggttataaactgacgctgacgatgccggagaccatgagcatcgaacgc
cgcaagctgctgaaggccctgggcgctaacctggtgctgaccgaaggcgccaaggggatg
aaaggcgccatccagaaagccgaagaaattgtcgccagcaacccggaaaaattcctcctg
ctccagcagttcagcaacccggccaacccggaaattcatgaaaaaaccaccggcccggaa
atctgggaagataccgatggtcaaatcgacatcttcatctccggcgtcggtactggcggt
acgctgaccggcgtgagccgctatatcaaaggcaccaaaggtaaaaaagatctgattacc
gttgccgttgaacctaccgactccccggttatcgcccaggcgctggcaggcgaagagctg
aagccaggcccgcacaaaatccagggtattggcgcaggctttatcccaggcaacctggat
ttgaagctggtggataaagtagtggctattaccaatgaagaagccatttccaccgcccgt
cgcctgatggaagaggaaggcattctggccggcatctcttccggcgctgccgttgccgct
gcgctgaagctgcaggaggatgaagcctttaccaacaagaatattgtggttatcctaccc
tcttcaggtgagcgctatttaagcaccgcattgtttgccgatctcttcaccgagaaagaa
ctgcaacagtaa

DBGET integrated database retrieval system