KEGG   Klebsiella oxytoca KCTC 1686: KOX_26835Help
Entry
KOX_26835         CDS       T01681                                 

Definition
cysteine synthase A
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Class
Metabolism; Overview; Carbon metabolism [PATH:kox01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kox01230]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:kox00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:kox00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5797418..5798389
Genome map
AA seq 323 aa AA seqDB search
MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLK
PGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGM
KGAIQKAEEIVASNPEKFLLLQQFSNPANPEIHEKTTGPEIWEDTDGQIDIFISGVGTGG
TLTGVSRYIKGTKGKKDLITVAVEPTDSPVIAQALAGEELKPGPHKIQGIGAGFIPGNLD
LKLVDKVVAITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDEAFTNKNIVVILP
SSGERYLSTALFADLFTEKELQQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatttttgaagataactccctgactatcggccatacgccgctggtacgactg
aaccgcatcggtaacggacgcatcctggcaaaggtagaatctcgtaacccgagctttagc
gtaaaatgccgtatcggtgccaatatgatttgggatgccgaaaaacgcggcgtgctgaag
cccggcgttgagctggtggaaccgaccagcggtaataccggtatcgcgctggcctacgtg
gctgcggcgcgcggttataaactgacgctgacgatgccggagaccatgagcatcgaacgc
cgcaagctgctgaaggccctgggcgctaacctggtgctgaccgaaggcgccaaggggatg
aaaggcgccatccagaaagccgaagaaattgtcgccagcaacccggaaaaattcctcctg
ctccagcagttcagcaacccggccaacccggaaattcatgaaaaaaccaccggcccggaa
atctgggaagataccgatggtcaaatcgacatcttcatctccggcgtcggtactggcggt
acgctgaccggcgtgagccgctatatcaaaggcaccaaaggtaaaaaagatctgattacc
gttgccgttgaacctaccgactccccggttatcgcccaggcgctggcaggcgaagagctg
aagccaggcccgcacaaaatccagggtattggcgcaggctttatcccaggcaacctggat
ttgaagctggtggataaagtagtggctattaccaatgaagaagccatttccaccgcccgt
cgcctgatggaagaggaaggcattctggccggcatctcttccggcgctgccgttgccgct
gcgctgaagctgcaggaggatgaagcctttaccaacaagaatattgtggttatcctaccc
tcttcaggtgagcgctatttaagcaccgcattgtttgccgatctcttcaccgagaaagaa
ctgcaacagtaa

DBGET integrated database retrieval system