KEGG   Klebsiella oxytoca KCTC 1686: KOX_27145Help
Entry
KOX_27145         CDS       T01681                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kox00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5858652..5860082)
Genome map
AA seq 476 aa AA seqDB search
MSGFKEGFLWGGAVAAHQLEGGWKEGGKGVSVADVMTAGAHGVPREITDGVLPGKNYPNH
EAIDFYHRYKDDIRLFAEMGFKCFRTSIAWTRIFPLGDEQEPNEAGLQFYDDLFDECLKH
GIEPVITLSHFEMPYHLVTEYGGWRNRKLIDFFVRFARVVFTRYQHKVKYWMTFNEINNQ
ANFHEDFAPFTNSGLKYLPGEDREPVMFQAAHYELVASALAVKAAREINPSLQIGCMIAM
CPIYPLSCAPNDMMMAMNAMHRRYWFTDVHVRGRYPQHLLNYFERRGFALDITEEDRVAL
TQGCVDYIGFSYYMSFATKATDDNPQLDYDESKSLVSNPYVQKSDWGWQIDPVGLRYSLN
WFWDHYQLPLFIVENGFGAIDVREADGSVDDQYRIDYLSAHIAEMKKAVVEDGVDLMGYT
PWGCIDLVSAGTGEMKKRYGFIYVDKDNEGNGTLARSRKKSFAWYQQVIGSNGEKL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtccggatttaaagaaggttttctgtggggcggcgcggtggcggcgcatcagctggaa
ggcggctggaaagagggcggtaaaggggtgagcgtcgccgacgtgatgaccgcaggcgcg
cacggcgtaccgcgcgaaatcaccgatggcgtgctgccggggaaaaactaccccaaccac
gaagcgatcgatttttatcatcgctataaagacgacattcgcctgtttgccgaaatgggc
ttcaaatgcttccgcacctccattgcctggacgcgcatctttccgctgggcgatgagcaa
gaacctaacgaggccgggctgcagttttacgacgacctgttcgatgagtgcctgaagcac
ggtattgagccggtgattacgctctcccacttcgaaatgccgtaccatctggtgacggag
tacggcggctggcgtaaccgtaaactgattgatttcttcgtccgctttgcccgggtggta
tttacccgctaccagcacaaagtgaagtactggatgaccttcaatgagatcaataaccag
gccaacttccacgaagattttgcgccgttcaccaactccggactgaaatatctgccgggg
gaggaccgcgagccggtcatgtttcaggcggcgcactatgagctggtcgccagcgcgctg
gcggttaaagccgcccgcgaaattaacccgtcattgcagattggctgcatgatcgccatg
tgtccgatttacccgctgagctgcgcgcccaacgacatgatgatggcgatgaacgccatg
catcgccgctactggtttaccgacgttcacgtgcgcggccgctatccgcagcacctgctg
aactacttcgagcgtcgcggttttgcgctggacatcaccgaagaagaccgcgtggcgctg
actcagggctgcgtcgactatatcggctttagctactatatgtcgttcgccacgaaagca
acggatgataatccgcagctggattacgatgaaagcaagagcctggtttccaacccgtac
gtgcagaagtcagactggggctggcagattgatccggtcgggctgcgctactccctgaac
tggttctgggaccattaccagctgccgctgtttattgtggagaacggctttggcgccatc
gacgtgcgcgaagcggacggctcggtggatgaccagtatcgtattgactacctttccgcc
catatcgccgaaatgaaaaaagcggttgttgaggatggcgtcgacctgatgggctatacc
ccgtggggctgtatcgacctggtttccgcgggaaccggtgagatgaaaaaacgctacggc
tttatctacgtggataaagataatgagggcaacggcacgctggcgcgtagccgtaagaaa
tcttttgcctggtatcagcaggttatcggcagcaacggcgaaaagctataa

DBGET integrated database retrieval system