KEGG   Klebsiella michiganensis HKOPL1: J415_07935Help
Entry
J415_07935        CDS       T03188                                 

Definition
(GenBank) glycoside hydrolase family protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    J415_07935
   00500 Starch and sucrose metabolism
    J415_07935
Enzymes [BR:koy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     J415_07935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1680515..1681948
Genome map
AA seq 477 aa AA seqDB search
MTYSISRAEQELQAKHEQLNLRWYPRYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
KWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PSDEANLYQVQCLATSRDGIHFERQGIVVDTPPGMHHFRDPKVWREGDSWYMIVGARDGD
TGQVRLYRSADLRQWQDAGVLDEAEKEMGYMWECPDFFALNGKHILMFSPQGLAAKGYQN
RNLFQSGYLLGEWRPGQAFVREGEFVEMDHGHDFYAPQSFLTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADNRLQMRPAKEVESMRGASFPWPVTTLKNQQTTMVENCE
AMEVILHWDGLNSSAEQYGLSFGEGLRVYVDAQMQRLVLERHYPQHGLCGTRSVPLNEGA
DLKLRIFFDSSSVEVFVNDGEACLSSRIYPDADRRELSLFAWNGSAYLTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgtattcaatttcccgggctgagcaagaactgcaggctaaacatgaacagctgaac
ctgcgctggtatccgcgctatcacctggccgcccgcgcgggctggatcaacgatcccaat
ggcctggtctggtttgacggctggtaccacgcgttttaccagcaccatccgtactccacc
aaatgggggccgatgcactggggtcacgcgcgcagtaaagatctggtgcactgggaacat
ctgccggtggcgctggccccggaaggccccgaggataaagacggctgcttctccggctcc
gcggtggtggatggcgatacgctggcattgatttataccgggcataaatttcatggcgat
cccagcgatgaagccaacctttatcaggtgcaatgtctggccaccagccgcgacgggatt
cacttcgagcgccaggggatcgtggtcgacaccccgccgggcatgcaccatttccgcgac
ccgaaagtgtggcgagaaggggacagctggtacatgatcgtcggcgctcgcgatggcgac
accggccaggtgcggctgtatcgttccgccgatctgcgccagtggcaggacgccggcgtc
cttgacgaggcggaaaaagagatgggctacatgtgggaatgcccggatttcttcgccctc
aacggcaagcatattctgatgttctctccgcaggggctggcggctaaaggctatcaaaac
cgcaacctgttccagagcggctatctgctcggtgaatggcggccggggcaggcgtttgtg
cgtgagggcgagtttgtggaaatggatcacggccacgacttttatgccccgcaaagcttc
ctcactcccgacggccgccgcattgtcatcggctggctggatatgtgggagtcgccgctg
ccggagcagcaggatggctgggcaggcatgctgtcgctgccgcgtgaactgagcctgagc
gcggataatcgactgcagatgcgtccggcgaaagaggtcgagagcatgcgcggcgccagc
ttcccgtggccggtgacgaccctgaaaaaccagcagaccacgatggtggagaactgcgaa
gcgatggaggtgatcctgcactgggatggcctgaacagcagcgccgagcagtatggcctc
agcttcggcgaaggtttgcgcgtttacgtggatgcgcagatgcagcgcctggtgctcgag
cggcactatccgcagcatggcctgtgcggcacccgcagcgtcccgttgaacgaaggcgcc
gatctgaagctaaggatattcttcgatagctcttccgtcgaagtgtttgttaatgatggc
gaggcctgtcttagcagtcgtatatatccggatgccgatcgtcgcgaattgtctttattt
gcctggaacggttcggcttatttaaccgaagccggcgcctggcagctggaataa

DBGET integrated database retrieval system