KEGG   Klebsiella michiganensis HKOPL1: J415_24190Help
Entry
J415_24190        CDS       T03188                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00052  Galactose metabolism
koy00500  Starch and sucrose metabolism
koy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    J415_24190
   00500 Starch and sucrose metabolism
    J415_24190
Enzymes [BR:koy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     J415_24190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AHW90221
Position
5072021..5073421
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPRALADSHYPRWHHAPVTGLMNDPNGFVEFAGRYHLFYQWNP
LACDHKFKCWAHWSSEDLLRWRHEPIALMPDEEYDRNGCYSGSAVDNNGTLTLCYTGNVK
FDDGGRTAWQCLATENADGTFRKIGPVLPLPEGYTGHVRDPKVWRHKDRWYMVLGAQDRQ
KRGKVLLFSSPDLHQWRSKGEIAGYGLNGLDDAGYMWECPDLFPLGDQHILICCPQGIAR
EDERFLNTYPAVWMSGDVDYDRAAFKHGELHELDAGFEFYAPQTMHTSDGRRLLVGWMGV
PDGEEMLQPTLASGWIHQMTCLRELEFIDGRLYQRPLRELTALRGEAHGWQGNALPLAPM
EIALQTAGDDALSLDFGGALTLERDASGIRLARRSLASDEMHYRYWRGEVRSLRIFIDRS
SVEIFINDGEGVMSSRCFPDYPAQLIFSGSAPDAFCYWPLRTCMIE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcactaccatcacgtctgcctgcgattttgcaggccgttatgcagggccagccgcgc
gcgctggccgatagccattatccgcgctggcaccatgcgccggtgaccgggctgatgaac
gaccccaacggctttgtcgagtttgccgggcgctatcatctgttctaccagtggaacccg
cttgcctgcgatcataagttcaagtgctgggcgcactggagttcagaggatctgctgcgc
tggcggcatgagcctattgcgctaatgccggatgaagagtacgaccgcaacggctgctac
tccggcagcgcggtggataacaacggtacgctcaccctgtgctataccggcaacgtgaag
tttgacgacggcggccgaaccgcgtggcagtgcctggcgacggaaaacgccgacggtacc
ttccgcaaaatcggtccggtcctgccgctgccggagggctataccggccacgtgcgcgac
ccgaaggtctggcggcataaagaccgctggtacatggtactgggagcgcaggatcggcaa
aagcgcggtaaggtgctgctgttcagctccccggaccttcatcagtggcgcagcaagggc
gaaatcgccggctacggcctcaatggcctcgacgacgctggctatatgtgggagtgtccg
gatctgtttccgctcggcgaccagcatattctgatctgctgcccgcaggggattgcccgc
gaagacgagcgcttcctcaatacctatccggcggtatggatgagcggcgatgtcgactac
gaccgcgccgcgttcaaacacggcgagctgcacgaactggacgccgggtttgagttttat
gccccgcaaaccatgcacaccagcgatggccgccgcctgctggtcggctggatgggcgtc
ccggacggtgaagagatgcttcagccgacgcttgccagcggctggatccaccagatgacc
tgcctgcgcgagctggaatttatcgacggccggctctaccagcgtccgctgcgcgagctg
accgccctgcgcggggaggcacacggctggcaggggaacgcactgccgctggcgccgatg
gaaatcgccctgcaaaccgccggcgacgacgcgctaagccttgatttcggcggcgcgtta
accctggagcgcgacgccagcggtatccgtctggcgcgacgcagcctcgccagcgacgaa
atgcactatcgctactggcgcggcgaggtgcgctcgctgcggattttcatcgatcggtcg
agcgtggagattttcatcaacgacggcgagggggtgatgagcagccgctgcttccccgat
tatccggcgcagctgattttctccggcagcgcgccggatgcattctgctactggccgctg
cgaacatgcatgatagaataa

DBGET integrated database retrieval system