KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_21550Help
Entry
KPNIH10_21550     CDS       T03788                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH10_21550
   00500 Starch and sucrose metabolism
    KPNIH10_21550
Enzymes [BR:kpc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPNIH10_21550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4423189..4424622)
Genome map
AA seq 477 aa AA seqDB search
MTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDCWYMIVGAREGD
TGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAGFSN
RNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNCE
AMEVNLRWDCARSSAEQYGLRFGDGLRIYMDAQQQRLVLERHYPQYGLCGTRSVPLTAGA
DLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGAAALTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacaatctcccgggctgaacaggtactccagacacaacgccaggcgcttaat
ctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaacgacccaaac
ggtctggtgtggtttgacggctggtaccatgccttttatcaacatcacccgtactccacc
cagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcactgggagcat
ttgccggtagccctggcgccggagggcccggaggataaagacggctgcttttccggctcg
gcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggcgat
cctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacgggatc
cactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccacttccgtgac
ccgaaggtctggcgtgaaggagactgctggtacatgatcgtcggcgcgcgcgaaggcgat
accggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggacgcgggggtg
ctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttcttcaccctc
aacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcggggttcagcaac
cgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccagcgttttatt
cgccatggcgaattccgggagatggataacggccacgatttctatgccccgcaaagcttc
tccacccccgatggccggcggatcgtgattggctggctggatatgtgggaatcgccgctg
ccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctgagcctgagc
gcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcctgg
ttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgacaactgcgag
gcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcagtatggtctg
cgctttggcgatggcctgcgcatctacatggatgcccaacagcagcgtctggtgctggaa
cggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgaccgccggggcg
gatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtcaatgacggc
gaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaattagcgttattt
gcctggagcggcgcggcggcattaaccgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system