KEGG   Klebsiella pneumoniae 342: KPK_0091Help
Entry
KPK_0091          CDS       T00772                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00010  Glycolysis / Gluconeogenesis
kpe00051  Fructose and mannose metabolism
kpe00562  Inositol phosphate metabolism
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01120  Microbial metabolism in diverse environments
kpe01130  Biosynthesis of antibiotics
kpe01200  Carbon metabolism
kpe01230  Biosynthesis of amino acids
Module
kpe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpe_M00002  Glycolysis, core module involving three-carbon compounds
kpe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_0091 (tpiA)
   00051 Fructose and mannose metabolism
    KPK_0091 (tpiA)
   00562 Inositol phosphate metabolism
    KPK_0091 (tpiA)
Enzymes [BR:kpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KPK_0091 (tpiA)
Exosome [BR:kpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KPK_0091 (tpiA)
  Exosomal proteins of bladder cancer cells
   KPK_0091 (tpiA)
  Exosomal proteins of melanoma cells
   KPK_0091 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: ACI11956
UniProt: B5XTE0
Position
complement(96349..97116)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVSGCAVAIAPPEMYLDLAKRAAEGSHIH
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgcgaacctgcgtaccgaactggctggcgtaagcggctgtgcagttgccatc
gccccgccggaaatgtatctggacctggctaaacgtgcggcagaaggcagccacattcac
ctgggcgcgcagaacgttgacgtgaacctgtccggcgcattcaccggtgaaacctccgcc
gaaatgctgaaagatatcggcgcacagtacatcatcatcggccactccgagcgtcgtacc
taccacaaagaatccgacgagctgatcgcgaagaaattcgctgtgctgaaagagcagggt
ctgaccccggtactgtgcatcggtgaaaccgaagccgaaaacgaagcgggcaaaaccgaa
gaagtttgcgcacgtcagatcgacgccgtgctgaaaacgcagggcgctgccgctttcgaa
ggcgtggttatcgcttacgaaccggtatgggctatcggtaccggcaaatccgcgaccccg
gctcaggctcaggcggtgcacaaattcatccgtgaccacattgctaaagctgacgcgaaa
atcgctgagcaagtgatcatccagtacggtggttccgttaacgctggcaacgcagcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcctccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagcagcgaaaaaagcgtaa

DBGET integrated database retrieval system