KEGG   Klebsiella pneumoniae 342: KPK_0216Help
Entry
KPK_0216          CDS       T00772                                 

Definition
glycosyl hydrolase family 8
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231695..232696
Genome map
AA seq 333 aa AA seqDB search
MPLRALVAVIVTTAVMLVPRAWADTAWERYKARFMMSDGRIIDTANGNVSHTEGQGFAML
LAVANNDRPAFDKLWQWTDSTLRDKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALL
RAQKQWQDKRYAIASDAITASLLKYTVVTFAGRQVMLPGVKGFNLNDHLNLNPSYFIFPA
WRAFAERTHLTAWRTLQTDGQALLGQMGWGKSHLPSDWVALRADGKMLPAKEWPPRMSFD
AIRIPLYLSWADPQSALLAPWKAWMQSYPRLQTPAWINVSTNEVAPWYMAGGLLAVRDLT
LGEPQEAPQIDDKDDYYSASLKQLVWLAKQDQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcgtgctttagtggcggtgatagtgacaacggcagtgatgctggtgccccgg
gcgtgggcggatacggcctgggagcgctataaggcccgttttatgatgtcggacggccgt
atcattgataccgccaatggcaatgtgtcgcatacggaaggtcagggctttgccatgctc
ctggcggtggcgaataacgatcgcccggcgttcgacaagctgtggcagtggacggacagc
accctgcgcgataagtctaacgggctgttttactggcgttataacccggtggcgccggac
cctatcgccgataaaaacaacgcctctgatggcgatacgctgatcgcctgggcgctgttg
cgtgcgcaaaagcagtggcaggacaagcgctacgcgattgcctcggatgccatcaccgcc
tccctgctgaaatatacggtggtgaccttcgccggtcgtcaggtgatgctcccgggcgtg
aaagggttcaatctcaacgaccatctgaaccttaatccctcctatttcatcttcccggcc
tggcgcgccttcgcggagcggacgcatctgaccgcctggcggacattgcagaccgacgga
caggcgctgctggggcagatggggtgggggaaatcacatctgcccagcgactgggtggcg
ctgcgggcggatggcaagatgctgccagccaaagagtggccgccgcggatgagtttcgat
gcgattcgtatcccgctgtatctctcgtgggccgatccgcaaagcgctttgctcgcgccg
tggaaggcctggatgcagagttacccgcgcctgcaaaccccggcgtggatcaacgtcagc
accaacgaggtggccccctggtatatggccggcggcctgctggcggtgcgcgatctgacg
ctgggtgaaccgcaggaggcgccgcagattgacgacaaggatgattattactctgccagc
ctcaagcagttggtctggctggcgaaacaggatcagcgttag

DBGET integrated database retrieval system