KEGG   Klebsiella pneumoniae 342: KPK_0224Help
Entry
KPK_0224          CDS       T00772                                 

Gene name
bcsZ
Definition
(GenBank) cellulase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
kpe  Klebsiella pneumoniae 342
Brite
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KPK_0224 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
242308..243414
Genome map
AA seq 368 aa AA seqDB search
MKVLCGAVLSALLLAAGPVSAACQWPAWEQFKKAYVSPEGRVIDPSDARKISTSEGQSYG
LFFALAANDRAGFDKLLTWTQNNLAEGDLRQHLPGWLWGKKDDEQWTLLDSNSASDSDLW
IAWALLEAGRLWQQPQYTETGKALLARIVEEETVAVPGLGTMLLPGKVGFADDSGWRFNP
SYLPPQLATYFVRFGAPWPALRDSNLRLLLETAPKGFTPDWVRYEKGKGWQLKTEKPLIG
SYDAIRVYLWVGMLHDGDKQKARLLQRFAPMAAQTTEQGVPPEKVNIATGKTSGQGPVGF
SAVMLPFLQDDEARSVQRQRVADNYPGADAYYSAVLTLFGQGWDQHRFRFTAGGELQPDW
NQECASSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtactttgtggcgcggtgctctccgcgctgctgctggcggcgggcccggtgagc
gccgcctgccagtggcccgcctgggagcagtttaaaaaagcgtacgtcagccctgaggga
cgggtgattgaccccagcgatgcgcgcaaaatctccacctcggaaggacagagctatggc
ctgtttttcgccctggccgccaacgatcgcgcagggttcgacaaactactgacctggacg
cagaacaacctggcggaaggcgacctgcggcaacatctgccgggctggctgtggggcaaa
aaggacgatgagcagtggacgttgctggacagcaactcggcctccgactcggatctgtgg
atagcctgggcgctgctggaggcgggccgcctgtggcagcagccgcagtacaccgagacc
ggaaaagcgctgctggcgcggattgtcgaggaagagacggtggcggtacccggccttggc
acgatgctgctgccgggaaaagtcggttttgccgatgacagcggctggcggtttaacccc
agctatcttccgccgcagctggccacctactttgtgcgttttggcgcgccgtggcctgcc
ctgcgcgacagcaacctgcgcctgctgctggagaccgcgccgaaaggctttaccccggac
tgggtgcgctatgagaaagggaaaggctggcagctgaaaaccgaaaagccgctgatcggc
agctatgacgcgattcgcgtctacctgtgggtgggcatgctccatgatggcgataagcag
aaagcgcgcctgctgcaacgcttcgcgccgatggcggcgcagaccacggagcagggggta
ccgccggagaaagtgaatatcgccaccggcaaaaccagcggccaggggcccgtgggcttc
tccgcggtgatgctaccgtttttacaggacgacgaggcccggtcggtgcaacgccagcgc
gtcgccgataactatcccggcgcggatgcctactacagcgcagttctgacgctgttcggc
cagggttgggatcaacaccgttttcgtttcactgcgggtggcgaattacaacctgactgg
aaccaggaatgcgcaagctctcactaa

DBGET integrated database retrieval system