KEGG   Klebsiella pneumoniae 342: KPK_0224Help
Entry
KPK_0224          CDS       T00772                                 

Gene name
bcsZ
Definition
(GenBank) cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
kpe  Klebsiella pneumoniae 342
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
242308..243414
Genome map
AA seq 368 aa AA seqDB search
MKVLCGAVLSALLLAAGPVSAACQWPAWEQFKKAYVSPEGRVIDPSDARKISTSEGQSYG
LFFALAANDRAGFDKLLTWTQNNLAEGDLRQHLPGWLWGKKDDEQWTLLDSNSASDSDLW
IAWALLEAGRLWQQPQYTETGKALLARIVEEETVAVPGLGTMLLPGKVGFADDSGWRFNP
SYLPPQLATYFVRFGAPWPALRDSNLRLLLETAPKGFTPDWVRYEKGKGWQLKTEKPLIG
SYDAIRVYLWVGMLHDGDKQKARLLQRFAPMAAQTTEQGVPPEKVNIATGKTSGQGPVGF
SAVMLPFLQDDEARSVQRQRVADNYPGADAYYSAVLTLFGQGWDQHRFRFTAGGELQPDW
NQECASSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtactttgtggcgcggtgctctccgcgctgctgctggcggcgggcccggtgagc
gccgcctgccagtggcccgcctgggagcagtttaaaaaagcgtacgtcagccctgaggga
cgggtgattgaccccagcgatgcgcgcaaaatctccacctcggaaggacagagctatggc
ctgtttttcgccctggccgccaacgatcgcgcagggttcgacaaactactgacctggacg
cagaacaacctggcggaaggcgacctgcggcaacatctgccgggctggctgtggggcaaa
aaggacgatgagcagtggacgttgctggacagcaactcggcctccgactcggatctgtgg
atagcctgggcgctgctggaggcgggccgcctgtggcagcagccgcagtacaccgagacc
ggaaaagcgctgctggcgcggattgtcgaggaagagacggtggcggtacccggccttggc
acgatgctgctgccgggaaaagtcggttttgccgatgacagcggctggcggtttaacccc
agctatcttccgccgcagctggccacctactttgtgcgttttggcgcgccgtggcctgcc
ctgcgcgacagcaacctgcgcctgctgctggagaccgcgccgaaaggctttaccccggac
tgggtgcgctatgagaaagggaaaggctggcagctgaaaaccgaaaagccgctgatcggc
agctatgacgcgattcgcgtctacctgtgggtgggcatgctccatgatggcgataagcag
aaagcgcgcctgctgcaacgcttcgcgccgatggcggcgcagaccacggagcagggggta
ccgccggagaaagtgaatatcgccaccggcaaaaccagcggccaggggcccgtgggcttc
tccgcggtgatgctaccgtttttacaggacgacgaggcccggtcggtgcaacgccagcgc
gtcgccgataactatcccggcgcggatgcctactacagcgcagttctgacgctgttcggc
cagggttgggatcaacaccgttttcgtttcactgcgggtggcgaattacaacctgactgg
aaccaggaatgcgcaagctctcactaa

DBGET integrated database retrieval system