KEGG   Klebsiella pneumoniae 342: KPK_0316Help
Entry
KPK_0316          CDS       T00772                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPK_0316 (glgB)
Enzymes [BR:kpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     KPK_0316 (glgB)
Exosome [BR:kpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPK_0316 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344036..346222
Genome map
AA seq 728 aa AA seqDB search
MSNHIDRDVINALIAGHFADPFSVLGMHRTDAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDSRGFFSGVLPRRKNAFRYQLAVTWHGQQNLIDDPYRFGPLLQDLDVWLLSEGTHLR
PYETLGAHAATMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRFRKESGIWELFVP
GAHNGQLYKFELIDAHGHLRVKADPYAFESQMRPESASLICDLPPKVEQPADRKAANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPADDFALASFDGTSLYEHS
DPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDYSRKAG
EWIPNEYGGRENLEAIEFLRSTNRILGEQTPGAVTMAEESTDFAGVTRPPAGGGLGFWFK
WNLGWMHDTLDYMKLDPVHRRYHHDKMTFGMLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWLFAFPGKKLLFMGNEFAQGREWNHDGSLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDPYGFEWLVVDDHERSVFVFVRRDRAGNEIIVASNFTPV
PRHDYRFGINQPGRWREALNTDSMHYHGSNQGNGGVVESDAIASHGREHSLSLTLPPLAT
IWLVREAQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcatattgatagagacgtgattaatgcgctaatcgccggtcatttcgcggat
cccttttccgtgctcggcatgcaccgaactgacgccgggctggaagtgcgcgcattatta
cccgatgccaccgacgtgtgggttattgaaccgaaaaccggacgcaaagtcggcaagctc
gaatgcctcgactcgcgtggtttcttcagcggcgtcctgccacgtcgcaaaaacgccttt
cgctatcagctggccgtcacctggcacgggcagcagaatctgattgatgacccttatcgc
tttggtccgctgttgcaggatcttgatgtctggctgctgtccgaagggacccacctgcgc
ccttacgaaacgctgggcgcgcacgctgccaccatggacggcgtcaccggtacccgtttc
tcggtgtgggcgccgaatgcccgccgcgtgtcggtggtggggcagtttaactactgggat
ggcagacgccacccgatgcgattccgcaaagagtccgggatctgggagctgttcgttccc
ggcgcgcataatggccagctgtataaattcgaactgattgacgcccacggccatctgcgg
gtcaaagccgacccttacgcctttgagtcgcaaatgcgtccggaaagcgcctcgcttatc
tgcgacctgccgcccaaagtggaacagccggcggaccgcaaagcggcgaaccagtttgat
gccccgatctctatctatgaagtgcatctcggctcctggcgccgtcataccgataataat
ttctggctgagctaccgcgagctggccgaccagctggtgccctacgcgaaatggatgggc
ttcacccatctcgaactgctgccggttaacgagcacccgttcgacggcagctggggctat
caacccaccgggctctatgcgccgacccgccgtttcggcacccgcgacgatttccgttac
tttatcaacgccgcgcacgccgccgggctgaacgtcattcttgactgggtgcccggccac
ttcccggcggatgattttgcccttgcctcgtttgacggtacttcgctgtatgagcacagc
gatccacgcgagggatatcaccaggactggaataccctgatctacaactatggtcgccgc
gaagtcagcaacttcctcgtcggtaacgcgctgtactggatcgagcgcttcggtattgat
gccctgcgggtcgacgcggtggcctcaatgatctatcgcgattacagccgcaaggcaggt
gagtggatccccaacgaatacggcggccgggaaaatctggaagctattgagtttctgcgc
agcaccaaccgcatcctcggcgaacagacgccgggcgcggtgacgatggcggaagagtcc
accgattttgctggcgtcacccgtccgcctgccggcggtgggttgggcttctggttcaaa
tggaacctcggctggatgcacgacaccctggattacatgaagctcgatccggtgcatcgc
cgctaccatcacgacaaaatgaccttcggcatgctctataactacaccgagaacttcgtg
ctgccgctctcccatgacgaggtcgtacacggcaaaaaatcgattctcgaccgcatgccg
ggggatgcctggcagaagtttgccaacctgcgcgcctactacggctggctgttcgccttc
ccgggtaaaaaactgctgtttatgggcaatgagttcgctcaaggccgcgagtggaaccac
gacggcagcctcgactggcatctgctggagggcggcgacaactggcaccacggcgtccag
cgactggtgcgcgacctgaaccatacctaccgtcaccataaagcgctgcacgagctggat
tttgacccctacggtttcgaatggctggtggtcgacgaccatgagcgttcggtgtttgtc
tttgtgcgccgcgaccgggccgggaatgagattatcgtcgccagcaacttcacgccggtg
ccgcgccatgactaccgcttcggcattaaccagccgggacgctggcgcgaggcgttgaat
accgactccatgcactatcacggcagcaaccagggtaacggcggtgtggtggagagcgac
gcgatcgccagccatggccgcgaacattcgctatcgttgaccctgcctccgctggcgacg
atctggctggtccgggaggcgcaatga

DBGET integrated database retrieval system