KEGG   Klebsiella pneumoniae 342: KPK_0329Help
Entry
KPK_0329          CDS       T00772                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363871..365967
Genome map
AA seq 698 aa AA seqDB search
MESKRLDNAALAAGISPSYINAHGKPQSIAAVTKQRLLDAMHRSTAATKVAVNPLPNVKI
FTHGKKMSLPVAGRGEYQWILTTEDGKQYQGKTRGGETLPLPAKLPEGYHSLTLTQEGER
WHCRTIVAPARCYEPQPLKEGKKLWGTCVQLYTLRSEKNWGIGDFGDLRAMLPEIARRGG
SFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSEEAQAWWQSAATQQ
ALQAARQTDDVDYTAVTTLKMTALRMAWKRFSRREDEQMTAFREFVLREGESLYWQAAFD
ALHAWQVQQDPLRWGWPAWPKAFQDIDSPEVKAFCIEHEDDVSFYLWLQWLAWSQFAACW
ETSQRDGMPIGLYRDLAVGVAEGGSETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHIIAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
SLLALESQRHRCMVIGEDLGTVPVEIVSKLRNSGVYSYKVLYFESDAEKTFRAPALYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKALGLYPDEVVLRGLYQDRELAKQGLLDALHKYGC
LPKRAGHKASLMSMTGILNRGMQRYIADSNSALLGLQPEDWLEMASPVNIPGTSTEYPNW
RRKLSVTLEQMFADEQVNKLIKDLDKRRKAASKKAAAR
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgcctcgataatgccgcgctggcggcgggcatcagccccagctatatc
aatgcgcacggtaagccgcagtctatcgcggctgtcaccaaacagcgcctgctggatgcg
atgcatcgctctaccgccgccacgaaagtggcggttaacccgctgccgaacgtgaaaatt
ttcacccacggcaaaaaaatgtcgctgccggtggcaggacgcggtgagtatcagtggatc
ctgaccactgaggacggtaagcagtatcaagggaaaacccgcggcggcgagacgctgccg
ctgccggctaaactgccggaggggtaccactccctgacgctcacccaggagggagagcgt
tggcactgccggaccatcgtcgcgccggcgcgctgctatgaaccgcagccgctgaaagag
gggaaaaagctgtggggcacctgcgtgcagctttataccctgcgctcggagaaaaactgg
gggatcggcgattttggcgatctgcgggccatgttgccggaaatcgcccgccgcggcggg
tcgtttattggccttaacccgatacatgctctctatccggcgaacccggagagcgccagt
ccgtatagcccgtcttcacgtcgctggctgaacgtcatctacatcgacgttaatgcggtt
gaagatttccagcgtagcgaagaggcgcaggcgtggtggcagtccgcagcgacccagcag
gccttgcaggcggcgcggcaaacggatgatgtcgactataccgcggtcaccacgctgaaa
atgaccgcgctgcgtatggcgtggaaacgattctctcgtcgtgaagatgagcagatgaca
gcgttccgcgagtttgttctgcgcgaaggggaaagcctctactggcaggccgctttcgat
gcgcttcacgcctggcaggtacaacaggacccgctgcgctggggctggccggcctggccg
aaggcctttcaggatatcgacagcccggaggtgaaagccttctgcattgagcatgaggac
gacgtcagtttctatctctggctgcagtggctggcctggagccagttcgccgcctgctgg
gaaaccagccagcgcgacgggatgccgattggcctctaccgcgatctggcggtgggcgtc
gccgaaggcgggtcggagacctggtgcgaccgtgagctgtactgcctgaaagcgtccgtg
ggcgcgccgccggatattctgggcccgctgggccagaactggggcctgccgccgatggat
ccgcatattattgccgctcgcgcctatgagccgtttattgatctgctgcgcgccaatatg
cagaactgcggcgcgctgcgcatcgatcacgtgatgtcggtgctgcgtttgtggtggatc
ccctatggtgaaaccgccgaccatggcgcttacgttcagtatcccgtcgacgatctgctg
tcgcttctggcgctggaaagccagcgtcatcgctgcatggtgatcggcgaagacctgggc
acggtaccggtggagattgtcagcaagttacgcaacagcggcgtctattcttataaagtg
ctctattttgagagtgatgcagagaaaacgttccgcgcgccggcgctgtacccggagcaa
tcaatggctgtggcgacgacgcacgacctgcccaccctccgcggctactgggaaagcggc
gatctgacgctaggtaaagcgctggggctctatcctgatgaggtggtgctgcgcgggctg
taccaggaccgcgagctggcgaagcaagggctgctggatgcgttgcataagtacggctgt
ctgcccaaacgtgccgggcataaggcctctctgatgagcatgaccgggatcctcaaccgg
gggatgcagcgttacattgctgacagtaacagtgcgctactgggcctgcagccggaagac
tggctggagatggcgtcgccggttaacattccgggcaccagcactgagtacccgaactgg
cgccggaagctgtccgtcaccctggagcagatgtttgccgatgaacaggtcaataagctg
attaaggatctggataaacggcgcaaggcggcgagcaagaaagccgccgccagatga

DBGET integrated database retrieval system