KEGG   Klebsiella pneumoniae 342: KPK_0777Help
Entry
KPK_0777          CDS       T00772                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
kpe  Klebsiella pneumoniae 342
Brite
Enzymes [BR:kpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KPK_0777 (dsbC)
Secretion system [BR:kpe02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KPK_0777 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
785254..785967
Genome map
AA seq 237 aa AA seqDB search
MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTDSGVLYV
TDDGKHIIQGPMYDVSGAQPINVTNQLLVGKLNALSNEMIVYKAPKEQHVITVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAIWCAKDRNKALDDAMNGKGVQ
PASCNVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHKKQTSGN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttattgatgttcactctgctggcagcctcgctttccggcgcggcgcat
gccgatagcgcggcgatcaaacagtcgctggcgaagctgggtgtgcagagtactgatatt
caaccgtcgccggtttccgggatgagcacggtgctgaccgacagcggcgtcctgtacgtt
accgacgatggcaaacacatcatccaggggccgatgtacgatgtgagcggcgcgcagccg
atcaacgtcaccaaccagttgctggtcggtaagctgaacgcgctgagcaacgagatgatt
gtctataaagcgccgaaggagcagcacgtcattaccgtctttaccgacatcacctgcggc
tactgccataaactgcacgagcagatgagcgactacaacgcgctgggcattaccgtgcgc
tatctggccttcccgcgccaggggctgcagagccaggccgagcaggacatgaaggccatc
tggtgtgcgaaagatcgcaacaaagcgctggatgacgccatgaacggcaaaggcgtgcag
ccggcaagctgcaatgtggatatcgccaaacattacaccctcggcgtgcagatgggcgtc
aacggcaccccggcgatggttctcagcaacggtatggtgttgccgggctatcaggggccg
aaagagctgaaagcgttcctcgacgagcataaaaaacagacaagcggtaactga

DBGET integrated database retrieval system