KEGG   Klebsiella pneumoniae 342: KPK_0887Help
Entry
KPK_0887          CDS       T00772                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KPK_0887 (recD)
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     KPK_0887 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900458..902302
Genome map
AA seq 614 aa AA seqDB search
MTFEQLLLAAVEQRLLRPLDVQFALMVAQNDPPAVMLAAALLSRDAGEGHVCLPLSRLSG
DEALSGKAGEIRDRLLAEAGAPEEWPALLLASSAVSCGDAPAPMILCGDRLYLNRMWRNE
LTVARFFNEANRVLEMDEARLASTLNALFPATGETDWQKVAAAVALTRRISVISGGPGTG
KTTTVAKLLAALIQIDDSPRCRIRLAAPTGKAAARLTESLGAALRKLPLTDAQKALIPTE
ASTLHRLLGAQPGSQRMRYHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPAHGRVIFLG
DRDQLASVEAGAVLGDICAWASSGYTAARAQELTRLTGSPVPAGEGAIAGALRDSLCLLQ
KSYRFGSHSGIGSLARAVNAGARAEVKATLRQPFDDIALHPLSTTEEYEAMLGAAQHGYE
RYLQLRRERAEPQAMLAAFSEFQLLCALREGPYGVSGVNERLEQRLNRQRAIALPRHSRW
YDGRPIMISRNDSALGLFNGDIGIALERNGELRVWFLMPDGTIKSVQPSRLPEHDTAWAM
TVHKSQGSEFEHAALILPARSVPLVTRELVYTAITRAKQRLSLYADEQVLSQAIVTRTER
RSGLAEIFAGREAP
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaacaattactgctggcggcggtggagcagcgtctgctgcggccgctggac
gtccagtttgccctgatggtggcgcaaaacgacccgccggcggtcatgctggcggcggcc
ttgctgagccgggatgctggcgaggggcacgtttgcctgccgctgtcgcggttgagcggc
gacgaggcgctgagcggaaaagcgggggagatccgcgatcggctgctggccgaagccggc
gcgccggaggagtggcccgcgctgctgctcgcttcgtcggcggtgagctgcggcgatgct
ccggcgccgatgattttgtgcggcgaccggctctatctgaaccggatgtggcgcaacgag
ctgaccgtcgcccgcttctttaacgaagccaaccgggtgctggagatggatgaggcgcgg
ctggcgtcaacgctaaatgcgctgtttcccgccactggcgaaaccgactggcaaaaagtg
gccgcggcggtggcgctgacccgccgtatctcggtgatctccggtggtcccgggaccggg
aaaaccaccaccgtggcgaagcttctggcggcgctgatccagattgacgacagtccacgc
tgtcgtattcgcctggcggcaccgacggggaaagcggcggcgcgcctgaccgaatcgctg
ggcgcggcgctgagaaagctgccgctgaccgatgcgcagaaagcgttaattcccaccgag
gccagcacgctgcatcgtctgctgggcgcccagcccggcagccagcgcatgcgctatcac
gccggcaacccgctgcatctggatgtgctggtcgtggatgaagcctcgatgattgacctg
ccgatgatgtcgcggcttatcgacgcgctgccggcccacgggcgggtgattttcctcggc
gatcgcgaccagctggcctccgtggaagcgggggcggtgctgggggatatctgcgcctgg
gcgagctcgggctacactgccgcgcgggcgcaggagctgacccggctgaccggttcgccg
gtgccggcgggcgagggggctatcgctggcgcgctgagagacagcttgtgcctgctgcaa
aagagctatcgcttcggcagtcactccggcatcgggagcctggcgcgggcggtgaatgct
ggcgcgcgcgcggaggtgaaggccacgctgcgccagccgtttgacgatatcgcgcttcat
cccctcagcacgactgaagagtacgaggccatgctcggcgcggcccagcatggctatgaa
cgctacctgcagctgcgccgcgagcgggccgaaccgcaggccatgctggccgctttcagc
gaattccagctgctgtgcgcgctgcgcgaagggccgtacggcgtgagcggcgtcaatgag
cggctggagcagcggctcaaccgccagcgggcgatcgccctgccgcgccactcccgctgg
tatgacggccgaccgatcatgatatcgcgtaacgacagcgcgctggggctgtttaacggt
gatatcggcatagcgctggagcgcaacggcgagctgcgggtgtggttcctgatgcccgac
ggcaccatcaagtcggtgcagccgagtcgcctgccggagcatgataccgcctgggcgatg
accgtgcataaatcgcagggctccgagttcgaacatgcggcgctgatcctgccggcgcgc
agcgtcccgctggtgacccgcgaactggtctacacggcgatcacccgcgcgaaacagcga
ttgtcgctctatgccgacgagcaggtgctctcccaggccattgtgacgcgcaccgagcgg
cgcagcggcctggcggagattttcgccgggcgcgaagccccctga

DBGET integrated database retrieval system