KEGG   Klebsiella pneumoniae 342: KPK_0968Help
Entry
KPK_0968          CDS       T00772                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPK_0968 (fucA)
Enzymes [BR:kpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KPK_0968 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977319..977966
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEDKIVFIDA
DGQHEQGKLPSSEWRFHQAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVAVALKHRKATLLQHHGLIACEASLEKALWLAHEVEVLAQL
YLSTLAIIDPVPVLNDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaacagactggcccggcagattatcgatacctgcctggaaatgacccgcctg
gggttaaatcaggggaccgccggcaatgtcagcgtgcgctatcagggaggaatgttgatc
acccccaccggtatcccgtatgaaaagctgacggaagacaagatcgtctttattgatgcc
gacggccagcatgagcagggaaaactgccctccagcgaatggcgttttcatcaggcggcc
taccagacgcggcccgatgcccaggcggtggtccacaatcacgctgtccattgtacggcg
gtgtcgatcctcaaccggcccatcccggccatccactatatgatcgccgcggccggcggg
aattcgatcccctgcgcgccctatgccaccttcggcacccgcgagctgtctgagcatgtc
gcggtagcgctgaagcaccgcaaagccacgctgctgcagcatcatggcctgatcgcctgc
gaggccagcctggagaaagcgctctggctggcgcatgaagtggaagtcctggcccagctc
tatctcagcacgctggcgattatcgacccggtaccggtgctgaatgacgaggcgatcgcc
atcgtgctggagaagttcaaaacctacggattacgtattgaagagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system