KEGG   Klebsiella pneumoniae 342: KPK_1158Help
Entry
KPK_1158          CDS       T00772                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KPK_1158
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     KPK_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1169088..1170038)
Genome map
AA seq 316 aa AA seqDB search
MDNLFHQPQGGNEMPRFAGRATMMRLPFIEDLQGLDAAFVGIPLDIGTSQRSGTRYGPRY
IRAESVMIRPYNMATGAAPFDSLSVADIGDVPINTYSLLKSVQIIEDYYTGLNSYPLIPL
TLGGDHTITLPILRALTKKHGPVGLIHVDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDL
KRVVQIGQRAQGYAAGDFQWGVDQGFRLVQAEQCWHTSLAPLMAEVRQQMGDGPVYLSFD
IDSLDPIWAPGTGTPEVGGLTSIQALEIVRGCRGLNLIGADLVEVSPPYDVSGNTSQLAA
NLLYEMLCVLPGVKYA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggataacctctttcaccaaccgcagggtggcaatgagatgccacgcttcgccggccgc
gccacgatgatgcgcctgccgtttatcgaagatttacagggacttgatgcggcatttgtc
ggcattccgctggatatcggcacctcgcagcgctcaggtacgcgctacggaccgcgctat
attcgcgccgaatcggtgatgatccgtccgtacaatatggcaaccggcgccgcgccgttc
gactcgctgtcggtggccgacatcggcgatgtgccgatcaatacctacagcctgctcaaa
tcggtgcaaattatcgaagattactacaccggtttgaatagttatccgctgatcccgcta
accctcggcggggaccacaccattaccctgccgatcctgcgggcgctgaccaaaaaacat
ggtccggtggggctcatccacgtcgacgcccataccgataccaatgatgagatgttcgga
gagaaaatcgcccacggcaccaccttccgccgcgccgttgaggagggactgctcgacctc
aaacgggtggtgcagattggccagcgcgcccagggctacgccgccggcgacttccagtgg
ggcgttgaccagggctttcgcctggtgcaggcggagcagtgctggcatacctcgctggcg
ccgctgatggccgaagtccgtcagcagatgggcgacggaccggtgtatctcagctttgat
atcgacagcctcgatcccatctgggccccgggaaccgggacgccggaagtcggcggcctg
acctccattcaggcgctggagatcgtccgcggctgccgcggcctgaacctgattggcgcc
gatctggtcgaggtctcgcccccctacgacgtgagtggtaatacctcccagctggcggcc
aacctgctgtacgagatgctctgcgtcctgcccggcgtgaagtacgcctga

DBGET integrated database retrieval system