KEGG   Klebsiella pneumoniae 342: KPK_1401Help
Entry
KPK_1401          CDS       T00772                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:kpe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpe00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kpe00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpe00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kpe00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:kpe00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1423425..1424390
Genome map
AA seq 321 aa AA seqDB search
MTKFALVGDVGGTNARLALCDLASGEISRAKTYSGLDYPSLEAVVRVYLEEHQVTVNEGC
IAIACPITGDWVAMTNHTWAFSIAEMKRNLGFAHLEIINDFTAVSMAIPMLKAEHLIQFG
GSAPVAGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
LGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPREVTERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAYVQDIPVYLIV
HENPGLLGSGAHLRQTLGQVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttgctttagtaggagatgtcggggggaccaacgcccgcctggcgctatgt
gatctggcgagcggagagatctctcgtgctaagacctattccgggctcgattatcccagt
ctggaggcggtggtgcgcgtctatctggaggagcaccaggtgaccgtcaacgaaggctgt
atcgccattgcctgcccgatcaccggcgactgggtagcgatgaccaaccatacctgggcc
ttctccatcgctgaaatgaagcgcaaccttggctttgcccatctggagataattaacgat
tttaccgccgtttccatggccatcccgatgctgaaagccgagcacctcattcagtttggc
ggcagcgctccggtagcgggcaaaccgatcgccgtttatggcgccggaaccgggcttggc
gtggcgcatctggtgcacgttgacaagcgctgggtcagcctgccgggcgaaggcggtcat
gtcgattttgcgccgaacagcgaagaagaggggattattctggaagagctgcgcgccgag
ctggggcatgtttccgcagaacgcgtgctctcggggcccggactggtcaatttgtaccgc
gcgattgtgaagtctgatggccgcctgccggaaaacctgcagccgcgcgaggtcaccgag
cgagcgctggcggacagttgtaccgactgtcgccgggcgctgtcactgttctgcgtcatt
atgggccgcttcggcggaaacctggcgctgactctcgggacctttggcggcgtgtatatc
gccgggggcatcgtgccgcgcttcctggagttctttaaagcctccggcttccgcggcggt
tttgaagacaaaggccgtttcaaagcttatgttcaggatattccggtttacctgatcgtg
catgaaaacccgggcctgctgggctctggcgcgcatctgcgtcagacgctgggccaggtg
ttataa

DBGET integrated database retrieval system