KEGG   Klebsiella pneumoniae 342: KPK_1401Help
Entry
KPK_1401          CDS       T00772                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00010  Glycolysis / Gluconeogenesis
kpe00052  Galactose metabolism
kpe00500  Starch and sucrose metabolism
kpe00520  Amino sugar and nucleotide sugar metabolism
kpe00521  Streptomycin biosynthesis
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01120  Microbial metabolism in diverse environments
kpe01130  Biosynthesis of antibiotics
kpe01200  Carbon metabolism
Module
kpe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_1401 (glk)
   00052 Galactose metabolism
    KPK_1401 (glk)
   00500 Starch and sucrose metabolism
    KPK_1401 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    KPK_1401 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KPK_1401 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KPK_1401 (glk)
Enzymes [BR:kpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KPK_1401 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ACI09742
UniProt: B5XVU8
Position
1423425..1424390
Genome map
AA seq 321 aa AA seqDB search
MTKFALVGDVGGTNARLALCDLASGEISRAKTYSGLDYPSLEAVVRVYLEEHQVTVNEGC
IAIACPITGDWVAMTNHTWAFSIAEMKRNLGFAHLEIINDFTAVSMAIPMLKAEHLIQFG
GSAPVAGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
LGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPREVTERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAYVQDIPVYLIV
HENPGLLGSGAHLRQTLGQVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttgctttagtaggagatgtcggggggaccaacgcccgcctggcgctatgt
gatctggcgagcggagagatctctcgtgctaagacctattccgggctcgattatcccagt
ctggaggcggtggtgcgcgtctatctggaggagcaccaggtgaccgtcaacgaaggctgt
atcgccattgcctgcccgatcaccggcgactgggtagcgatgaccaaccatacctgggcc
ttctccatcgctgaaatgaagcgcaaccttggctttgcccatctggagataattaacgat
tttaccgccgtttccatggccatcccgatgctgaaagccgagcacctcattcagtttggc
ggcagcgctccggtagcgggcaaaccgatcgccgtttatggcgccggaaccgggcttggc
gtggcgcatctggtgcacgttgacaagcgctgggtcagcctgccgggcgaaggcggtcat
gtcgattttgcgccgaacagcgaagaagaggggattattctggaagagctgcgcgccgag
ctggggcatgtttccgcagaacgcgtgctctcggggcccggactggtcaatttgtaccgc
gcgattgtgaagtctgatggccgcctgccggaaaacctgcagccgcgcgaggtcaccgag
cgagcgctggcggacagttgtaccgactgtcgccgggcgctgtcactgttctgcgtcatt
atgggccgcttcggcggaaacctggcgctgactctcgggacctttggcggcgtgtatatc
gccgggggcatcgtgccgcgcttcctggagttctttaaagcctccggcttccgcggcggt
tttgaagacaaaggccgtttcaaagcttatgttcaggatattccggtttacctgatcgtg
catgaaaacccgggcctgctgggctctggcgcgcatctgcgtcagacgctgggccaggtg
ttataa

DBGET integrated database retrieval system