KEGG   Klebsiella pneumoniae 342: KPK_1416Help
Entry
KPK_1416          CDS       T00772                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPK_1416 (fadJ)
   01212 Fatty acid metabolism
    KPK_1416 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPK_1416 (fadJ)
   00650 Butanoate metabolism
    KPK_1416 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    KPK_1416 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    KPK_1416 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPK_1416 (fadJ)
   00310 Lysine degradation
    KPK_1416 (fadJ)
   00380 Tryptophan metabolism
    KPK_1416 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPK_1416 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KPK_1416 (fadJ)
   00281 Geraniol degradation
    KPK_1416 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    KPK_1416 (fadJ)
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KPK_1416 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KPK_1416 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KPK_1416 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1439312..1441456
Genome map
AA seq 714 aa AA seqDB search
MDTVSAFKLEVRADKIAVITIDAPGEKMNTLKAEFGNQVRGLIRQVRDDKSVRGVVFISA
KTDNFIAGADINMIARCRSAQEAEALARQGQQIMAEIHGLSIPVIAAIHGACLGGGLELA
LACHGRICSDDEKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMMLTGRQLRARQAL
KAGLVDEVVPQAILLQAAVELALKGRPASRDMPVRERVLAGPLGRHLLFHFVGKQTQRKT
QGNYPAVKRILQVVENGLAHGCSSGYAEEARAFGELAMTPQSQALRSIFFASTDLKKDRG
AEAEPGPLTSIAVLGGGLMGGGIAYVTACKGGLPVRIKDIQPRGINHALKYSWDLLNKQV
RQRRLRPSERDRQMAMISGATDYQGFAHRDVVIEAVFEDLALKQRMVSEVEQYCGPQTIF
ASNTSSLPIGDIAAQARRPGRVIGLHFFSPVEKMPLVEVIPHKGTDPQAIATVVQLAKRQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLVEGEPVEEIDKALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLESAFGERFSSPANIIDAILKDDRKGRKNNRGFYLYETKGRKSKKRPDPA
VYPLLGIDRPQSRLSAQQVAERCVMMMLNEAARCFDEQIIRSARDGDIGAVFGIGFPPFL
GGPFRYMDTIGAGEVAAILQRLAAQYGPRFTPCDTLLRMAEQGTTFWPADERLT
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggatactgtttccgcttttaagcttgaggtccgtgcggacaagatcgcggtgatcacc
atcgatgccccgggtgagaaaatgaataccctgaaagctgagttcggcaatcaggtgcgg
gggctgatacgtcaggttcgtgatgataagtcggtgcgcggcgtggtgtttatctccgcc
aaaacggataactttatcgccggcgcagacattaacatgattgcccgctgccgcagcgcg
caggaagcggaagcgctggcgcgccaggggcagcagattatggctgaaatccatggcttg
tcgatcccggtgattgccgccatccacggcgcctgcctcggcggcggtctggaactggcg
ctggcctgtcatggccggatctgtagcgatgacgaaaaaacccgactcggtttgccggaa
gtgcagcttggcctgctgccgggctccgggggaacgcagcgtttaccgcggctgattggc
gtcagtacagcgctggatatgatgcttaccggcaggcagctgcgtgcgcgccaggcgctg
aaggccggtctggtagacgaggtggttccgcaggcgattttattgcaggcggcggtggag
ctggcgctgaaggggcgaccggccagtcgggatatgcccgtacgcgaacgcgtgctggcg
gggcctttgggccgccatctgttattccatttcgtcggcaaacaaacgcagcgcaagacc
caggggaactatccggcggtgaagcgaattctgcaggttgtcgagaatggcctggcccac
ggttgcagcagcggttacgccgaagaagctcgcgcgtttggcgaactggcgatgaccccg
cagtcgcaagcgctgcgttcgatcttctttgccagtaccgatctgaaaaaagaccgtggc
gccgaagcagagcccggaccgctgacgagcattgcggtgctgggcggcggcctgatgggc
ggggggatcgcctatgtgaccgcctgtaagggcgggctgccggtgcgcattaaagatatc
cagccgcgtgggattaaccatgccttaaagtacagctgggatctgctgaataaacaggtc
cgccagcgtcgtctgcgccccagcgagcgcgatcgccagatggcgatgatctccggcgcc
accgactatcagggctttgctcatcgcgacgtggtgatcgaggcggtatttgaggacctg
gccctgaagcagcggatggtcagcgaagtggagcaatattgcgggccgcagaccatcttt
gcgtcgaacacctcatcgttaccgataggcgatattgccgcccaggcccgtcgccccggg
cgggtgatcggcctgcatttcttcagtccagtggaaaaaatgccgctggttgaagtgatc
ccgcataagggaaccgatccgcaggctatcgccaccgtggtgcaactggctaaacgtcag
gggaaaacgccgattgtggtggcggataaagcgggcttctatgtgaaccgcatcctcgcg
ccctatatcaatgaagcgatgcgcctgctggtggagggcgaaccggttgaagagattgat
aaggccctggttaaattcggtttcccggtagggccaatccagctactggatgaggttggc
atcgataccggcaccaaaattatccccgtgctggagagcgcgtttggagaacgttttagc
tcacctgcaaacatcattgacgcgattttgaaggacgatcgcaaaggtagaaaaaataat
cgtggtttctatctttatgagacaaaagggcgtaaaagcaaaaaacggcccgacccggca
gtctatccgctgctcggcatcgaccgcccccagtcgcggctctccgcccagcaggtggcg
gaacgctgtgtgatgatgatgcttaacgaggcggcgcgctgctttgatgagcagattatc
cgtagcgcgcgcgatggcgatatcggcgccgtctttggtatagggtttccgccatttctt
ggcggcccgttccggtatatggatactatcggcgcgggtgaagttgccgcgatcctgcag
cgcctggccgcccagtacggcccacgttttacaccctgtgacactttattacgcatggcc
gaacaggggacaaccttttggccagcggatgaacggctgacctaa

DBGET integrated database retrieval system