KEGG   Klebsiella pneumoniae 342: KPK_1591Help
Entry
KPK_1591          CDS       T00772                                 

Gene name
bglB
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_1591 (bglB)
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KPK_1591 (bglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1622093..1623487
Genome map
AA seq 464 aa AA seqDB search
MKTFPADFLWGGATAANQVEGAYLEEGKGLSTSDVQPHGVFGEVVERVPGDSGIKDVAID
FYHRYPEDIALFAEMGFNCLRVSIAWSRIYPNGDDAEPNEAGLAFYDKLFDEMAKHNITP
LVTLSHYEMPWALVKNYGGWGSREVIGFFERYARTVFSRYKNKVKLWLTFNEINMSLHAP
MTGVGLPAGSSKGEVYQAIHHQLVASALAVKACHELVPEGKIGNMLLGGLMYPLSCKPED
VFETLQENRSWQFFGDVQARGAYPGYMLRFFRDNGITLTITDADREALKTTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSINDDYRISYLNDHLVQAREAIDDGVELMGFTSWGPIDLVSASKAE
LSKRYGFIYVDRHDDGTGTLARSKKKSFDWYKEVIASRGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcccggcggattttttatggggcggcgcgaccgcggcgaatcaggtggaa
ggggcttatctggaagagggcaaaggcttatccacctccgatgtgcagccgcacggcgtg
ttcggcgaggtggtcgagcgcgtacccggcgacagcggtattaaggatgtggcgatcgat
ttttaccatcgctacccggaagatatcgctctgttcgccgagatgggctttaactgcctg
cgggtgtccatcgcctggagccgcatctatcccaacggcgatgacgccgagcccaacgaa
gccggtctcgcgttctacgacaagctgttcgacgagatggcgaagcacaacatcaccccg
ctggtgacgctgtcgcattatgaaatgccgtgggcgctggtaaaaaactacggcggctgg
ggcagccgggaggtgattggtttctttgagcgctacgcccgcacggtgttcagccgctat
aaaaataaggtcaaattgtggctgacctttaacgaaatcaatatgtcgctgcatgctccg
atgaccggcgtcggcctgccggccggcagcagcaaaggcgaggtgtatcaggcgattcac
caccagctggtggccagcgctctggcggttaaagcctgtcacgagctggtgcccgagggc
aaaatcggcaatatgctgctcggcgggctgatgtatcccctgagctgcaaaccggaagat
gtgtttgagacgctgcaggagaaccgcagctggcagttctttggcgacgtgcaggcgcgc
ggcgcgtacccgggctatatgctgcgctttttccgcgacaacggtatcacactcaccatt
accgatgccgatcgcgaggcgctgaaaaccaccgtcgactttatctcctttagctactac
atgaccggctgcgtcaccgccgacgaggcgctgaaccagcaggcgcgcggcaatattctc
agcatggtgccgaacccgcacctggcgagctcggagtggggctggcagatagacccgctg
ggcctgcgtacgctgctgaacgtgctgtgggatcgctatcagaagccgctgtttatcgtg
gaaaatggtctgggcgccaaggataaggtggaagccgatggcagcattaatgatgactac
cgcatcagttacctgaacgaccatctggtgcaggcgcgggaagccattgacgatggcgtt
gagctgatgggctttaccagctgggggccgattgacctggtgagcgcctcgaaggcggag
ctgtcgaagcgctatggctttatctatgtcgaccgtcatgatgacggcaccggcaccctg
gcgcgcagtaagaagaagagttttgactggtataaagaggtgattgccagccgcggcgcc
agcctgaaagcgtaa

DBGET integrated database retrieval system