KEGG   Klebsiella pneumoniae 342: KPK_1651Help
Entry
KPK_1651          CDS       T00772                                 

Gene name
galF
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPK_1651 (galF)
   00052 Galactose metabolism
    KPK_1651 (galF)
   00500 Starch and sucrose metabolism
    KPK_1651 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    KPK_1651 (galF)
Enzymes [BR:kpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KPK_1651 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1694798..1695694
Genome map
AA seq 298 aa AA seqDB search
MNMANLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHS
SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCAR
PVVGDNPFVVVLPDIILDGGTADPLRYNLAAMVARFNETGRSQVLAKRMPGDLSEYSVIQ
TKEPMVAEGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWAELERTQPGAWGRIQL
TDAIAELAKKQSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGTKFRESIKKLLA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggcgaatttgaaagcggttattccggtcgcaggactaggcatgcatatgctg
ccggccacaaaggcaattccaaaggagatgctgccgatcgttgataagccaatgattcag
tacattgttgacgaaatcgtcgccgccgggatcaaagagattgtcctggtgacgcactcc
tcgaagaatgcagtggaaaaccactttgatacctcctacgagctggaagccctgcttgag
cagcgcgtgaagcgccagctgctggcggaagtccaggccatttgcccgccgggcgtaacc
atcatgaacgtgcgccaggcacagccgctgggtctgggccactccatcctctgcgcccgc
ccggtagtcggggacaacccgtttgtggtggtgctgccggatatcattctcgatggcggc
actgcggacccgctgcgctataacctcgctgccatggtcgcccgttttaacgagaccggc
cgcagccaggtactggcgaaacgcatgccgggggatctctccgaatactccgttatccag
accaaagagcccatggtggcggaagggcaggtggcgcgtatcgttgagttcattgaaaaa
ccggacgaaccgcagaccctggactccgacctgatggcagtgggccgctacgtgctgtcg
gcagatatctgggctgaacttgaacgaacccagccgggcgcctggggccgtatccagcta
accgacgccattgccgaactggcgaagaagcagtccgttgacgcaatgctgatgaccggc
gaaagctatgactgcggtaaaaaaatgggctacatgcaggccttcgtcacctacgggatg
cgtaacctgaaagaaggtaccaaattccgcgaaagcattaaaaaactgctggcctga

DBGET integrated database retrieval system