KEGG   Klebsiella pneumoniae 342: KPK_2066Help
Entry
KPK_2066          CDS       T00772                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00900  Terpenoid backbone biosynthesis
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01130  Biosynthesis of antibiotics
Module
kpe_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPK_2066 (ispE)
Enzymes [BR:kpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     KPK_2066 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACI06971
UniProt: B5XW48
Position
complement(2132824..2133672)
Genome map
AA seq 282 aa AA seqDB search
MSRWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLTIEPRTDGQLRLLTPVAGVP
DEENLIVRAARLLMRAASESDRLPAGSGADISVDKRLPMGGGLGGGSSNAATVLVALNHL
WGCGLSEEELATLGLQLGADVPVFVRGHAAFAEGVGEILTPVEPEEKWYLVAHPGVSIPT
PVIFRDPELPRNTPRRSINTLLNCEFSNDCELIARKRFREVDAALSWLLEYAPSRLTGTG
ACVFAEFNTESAARQVLDTAPAWLNGFVARGVNLSPLKQALL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctggccctctcctgcaaaactgaatctgtttttatatatcaccggccagcgg
gccgatggctaccataccctgcagacgctgtttcagtttctcgactatggcgacaccttg
accatcgaaccgcgaactgacggtcaactgcgcctgctgacgccggtggccggcgtgccg
gacgaggagaacctgatcgttcgcgccgcgcgtctgctgatgcgtgccgccagcgaaagc
gaccgccttccggcgggtagcggcgccgatatcagtgtcgacaagcgcctgccgatgggc
ggcggcctgggcggcggctcatccaatgccgccaccgtgctggtggcgctcaaccatctc
tggggctgcggtctctcggaagaggagctggcgaccctgggccttcagctgggggccgat
gtgccggtcttcgtgcgcggtcatgccgcctttgccgaaggggtcggcgaaattctgacg
ccggtggagcccgaggaaaaatggtacctggtggcgcacccgggggtcagtattccgacg
ccagtcatttttcgcgatccggagctaccacgaaataccccgcgccggtcaattaatacg
ttattaaattgtgaattcagcaacgattgcgagcttatcgcaagaaaacgttttcgcgag
gttgatgcagcgctttcctggctgttagaatatgcgccgtcacgcctgaccggcacaggg
gcctgtgtgtttgctgaatttaacaccgaatccgctgcccgtcaggtgctggacactgcc
ccggcatggctaaacggctttgtggcgcgcggagttaacctttcgccgctcaagcaggcc
ctgctctga

DBGET integrated database retrieval system