KEGG   Klebsiella pneumoniae 342: KPK_2106Help
Entry
KPK_2106          CDS       T00772                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPK_2106 (galU)
   00052 Galactose metabolism
    KPK_2106 (galU)
   00500 Starch and sucrose metabolism
    KPK_2106 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    KPK_2106 (galU)
Enzymes [BR:kpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KPK_2106 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2173582..2174484
Genome map
AA seq 300 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEFESDLSRDNLAEMISRFDETGASQIMVEPVEDVTAYGV
VDCKGESLKPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHKTLGDDFKAWLETAVTK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattctaaagtcagaaaagcggttatcccggtagcgggattaggcacc
aggatgctgcctgccaccaaagcaattccaaaagaaatgctgccgctggtagataagccg
ttaattcagtacgttgttaatgaatgtatcgctgcaggaattactgaaattgttctggta
acgcactcatcgaaaaactctatcgaaaaccatttcgataccagttttgagctggaagcg
atgctggaaaaacgtgtaaaacgccagcttctggaagaagtgcagtctatttgcccgccg
cacgtgaccattatgcaagttcgtcagggcctggcgaaaggccttggtcacgccgtgctg
tgcgcacatccggtagtgggtgatgagccggtagcggttattctgccagacgttattctg
gatgaatttgagtccgatctgagccgtgataaccttgcggagatgatctctcgttttgat
gagactggcgccagccagattatggttgagcctgtcgaggatgtgaccgcgtatggcgtg
gtcgattgcaaaggcgaatccctgaagccgggcgaaagcgtgccgatggtgggcgtggtc
gagaagccaaaagctgacgttgcgccgtccaacctggcggtagtcgggcgctatgtcctc
agcgcagatatttggccgctgctggcgaagacccctccgggcgccggtgatgaaattcag
ctgactgacgcgattgatatgctgatcgagaaagaaacggttgaagcttatcatatgaag
ggcaagagccatgactgcggcaataagcttggctacatgcaggcgtttgtcgaatatggt
attcgtcacaagacgcttggtgacgattttaaagcctggctggaaaccgcggtgacgaag
taa

DBGET integrated database retrieval system