KEGG   Klebsiella pneumoniae 342: KPK_2205Help
Entry
KPK_2205          CDS       T00772                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPK_2205 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPK_2205 (mhpF)
   00650 Butanoate metabolism
    KPK_2205 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KPK_2205 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPK_2205 (mhpF)
   00622 Xylene degradation
    KPK_2205 (mhpF)
   00621 Dioxin degradation
    KPK_2205 (mhpF)
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPK_2205 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2274366..2275316
Genome map
AA seq 316 aa AA seqDB search
MRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVG
GLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCVPVVNLAAN
LHQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASIASQSAGPGTRANIDEFTETTSQ
AIEKVGGAGKGKAIIVLNPAEPPLMMRDTVYVLSELASQEAIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDKPVNLPGIGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEQMAGAMHSAAGATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacgtaaagtcgccattatcggctccgggaatatcggcaccgatttaatgatt
aaaatcctgcgccacggccagcatctggagatggcggtgatggtcggcatcgacccgcag
tcggatggcctggcccgcgcccggcgcatgggcgtcgcgaccacccacgaaggggtgggc
ggcctgatgcagatggcggaatttgccgacatcgattttgtttttgacgccaccagcgcc
ggggcgcacatcaaaaacgatgccgcgctgcgcgaagcgaagccggggatccgcgtcatc
gacctgacgccggcggcgattggcccgtactgcgtaccggtggtcaacctcgcggccaat
ctccatcagggcaacgtcaatatggtgacctgcggcgggcaggcgaccatcccaatggtc
gccgcggtctcgcgagtggcgaaggtgcattacgcggagatcgtggcctcgatcgccagc
caatccgccggaccgggcacgcgggccaatattgacgaatttaccgaaaccacctcgcag
gcgattgaaaaagtcggcggcgcgggcaagggcaaagcgattatcgtgctgaatccggcg
gagccgccgctgatgatgcgcgataccgtctacgtcctgagcgagctggcgtcgcaggag
gcgattgccgcctcgatcgccgaaatggcggcggcagtgcaggcttacgtcccaggctac
cggctgaagcagcaggtgcagtttgaggttatccccgaggataagccggtcaacctgccc
ggcatcggctgtttttccggcctgaaaaccgcggtttacctcgaagtggaaggggcggcg
cactatctgccagcgtacgcgggcaacctcgatattatgacctcggcggcgctggcgacg
gcggagcaaatggccggggcaatgcacagcgcggcgggagcgacagcatga

DBGET integrated database retrieval system