KEGG   Klebsiella pneumoniae 342: KPK_2503Help
Entry
KPK_2503          CDS       T00772                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPK_2503
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_2503
  Lipid metabolism
   00071 Fatty acid degradation
    KPK_2503
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPK_2503
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPK_2503
   00626 Naphthalene degradation
    KPK_2503
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPK_2503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2562094..2563104)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTHDHQVNVTEKTLRPLEYGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVQKVGPGVTSLKPGDRASVAWFFEGCGHCDYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVTANYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLELAASMGADLTINSRNEDAAKVIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLVEAFQFAAEG
KVVPKVTLRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgctgttgttacccacgaccatcaggttaacgtcacggaaaaaacgctgcgc
ccgctggaatacggtgaagcgttgttgaaaatggaatgctgcggcgtgtgtcatacggac
ctgcacgtgaaaaacggcgattttggcgataaaaccggcgtcattctcggccatgaaggg
atcggggtggtgcaaaaagtcggaccgggcgtcacctccctgaagccaggcgatcgcgcc
agcgtagcgtggttcttcgaaggctgcggccactgcgattactgtaacagcggcaatgag
acgctgtgccgctcggtgaaaaacgccggctataccgtcgacggcggcatggcggaagag
tgcatcgtcaccgccaactacgcggtaaaagtcccggacggcctcgactccgccgccgcc
agcagtatcacctgcgcgggcgtcactacctacaaagcggtcaaggtctctcacatcaaa
ccgggtcagtggatcgctatctacggtctcggcgggctgggcaacctggcgctgcagtat
gcgaagaatgtctttaacgccaaagtgatcgctatcgacgtcaacgacgggcagctggag
ctggcggcctcgatgggcgccgatctgaccatcaactcccgtaatgaagatgcggcgaaa
gtgattcaggaaaaaaccggcggcgcgcatgctgccgtggtgaccgcggtagctaaagcg
gcctttaactcagcggtggatgccgttcgtgccggtggccgcgtggtcgcggtgggcctg
ccgccggaggcgatgagcctcgatattccacgtctggtgctcgacggcatcgaggtggtc
ggttcgctggtcggtacccgtcaggatctggtggaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcaccctgcgcccgctggaagatatcaacgccatctttaaagag
atggagcagggtcagatccgcggccgtatggttatcgatctgcgcagctaa

DBGET integrated database retrieval system