KEGG   Klebsiella pneumoniae 342: KPK_2557Help
Entry
KPK_2557          CDS       T00772                                 

Definition
TENA/THI-4 family protein
Orthology
K03707  
thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Thiamine metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:kpe00730]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2615862..2616557)
Genome map
AA seq 231 aa AA seqDB search
MIIPAFSHGLYGRLRQLAAADWQHYVAHPFVQQLAEGTLAESAFRRYLTQDYLFLIHFAR
SYALLVSKLRTLPEMRAAAASMNAILNELPLHVGYCAQWGISEQEMATQPEAPETINYTR
YVLDIGHSGDALDLLVALMPCVAGYAEIGLGLLQHPATRLDDNPYASWIRNYGDEGYLHG
VNAALALLETVWQQRGSEARITELSEIFTTGTRLEAQFWQMGLNATAETRA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgataattcccgcgtttagccatggtctttacggccgtttacgccagctggccgccgct
gactggcagcactatgtggcgcatcctttcgtccagcagcttgccgagggcaccctggcg
gaaagcgcatttcgtcgctacctgacccaggattatctgtttctgatccactttgcccgc
agctatgcgctgctggtgagtaaactgcgcacgctgccggagatgcgggccgcggccgcc
tcaatgaacgccatcctcaacgaactgccgctgcacgtcggttactgcgctcagtggggc
attagcgagcaggagatggctacccagcctgaagcgccggaaaccattaactatacccgc
tacgtgctggatattggccactcgggtgacgcgctggatctactggtcgcgctgatgccc
tgcgtggccggttatgcggaaatcggtctcggcctgctgcagcatcccgccacccgactg
gacgataacccctacgcctcgtggatccgcaactatggcgatgaaggctatctgcacggc
gtcaatgccgcgctggcgctgctggaaacggtatggcagcagcgcgggagcgaggcccgg
atcactgagctgagcgagattttcaccaccggcacccgccttgaggcgcagttctggcag
atgggcctcaacgcgacagcggagacccgggcgtga

DBGET integrated database retrieval system