KEGG   Klebsiella pneumoniae 342: KPK_2645Help
Entry
KPK_2645          CDS       T00772                                 

Definition
peptidase, ArgE/DapE family
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPK_2645
  Amino acid metabolism
   00300 Lysine biosynthesis
    KPK_2645
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KPK_2645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2705067..2706209)
Genome map
AA seq 380 aa AA seqDB search
MTTTLELARQLLGFNTINPPGSEADCMRFFADWLDDSGFEVSLSSFGEGRCNLIASLPGV
KSGKPLAFTGHLDTVPLGNARWQYDPFGSQMEDGRLYGRGSSDMKAAIAAFAVACVHQRE
AILAGRGAVLLITGGEETGCDGARALIASATLPEVGALIVGEPTANYPVIGHKGALWLRC
ETRGKTAHGAMPELGINAIYLAADALGKIQHFSPGAPHPLMKQPTLNVGRIEGGLNINSV
PDRTRFDVDIRSAPNLQHATIRERLTTLLGESVTVSTLVDLPAVLSREDHAWIKQVYQRC
QPLHAEPIAPRVVPYFTDASLLLPALGDPPCIILGPGEPSMAHQTDEYCLLSRLAEAEQL
YGDIIRDWMASPPATKVKNE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacccttgagctcgcccggcagctgctgggctttaacaccattaacccgccg
ggcagcgaagctgactgcatgcggttcttcgccgactggcttgacgatagcggttttgag
gtttcgctgtcgtcgttcggcgagggacgctgcaatcttatcgccagccttcccggggtg
aagagcggtaaaccgctggcctttaccggacatctggataccgtcccgctgggaaatgcc
cgctggcagtacgatccttttggctcgcagatggaagacgggcgtctttatggccgcgga
tccagcgatatgaaagcggcgatagcggcgtttgccgtcgcctgcgttcatcagcgggaa
gcgatcctcgccggacgcggcgcggtattgctgataaccggcggagaagagaccggctgc
gacggcgcgcgggcgctgatcgcctccgcaacgttgccggaggtgggcgcgctgatcgtc
ggtgaacccaccgccaactatccggttatcggccataaaggcgcgctctggctacgctgc
gaaacgcgggggaaaaccgcccacggcgcgatgccggagctggggatcaatgctatctat
cttgcggcggatgcgttgggtaagattcagcatttttcgccaggcgcgccgcatccgcta
atgaagcaacccaccctcaacgtcggacgcatagaaggcggactcaatattaattccgta
ccggaccgcacgcgttttgatgtcgatatccgcagcgcgcccaatttacagcacgccact
atccgggagcgcttgacgacgctgcttggcgaaagcgtcaccgtctccacgctggtcgac
ctgcctgccgtcctcagccgggaggatcacgcgtggattaagcaggtttaccaacgctgt
cagccgctgcacgctgagccgattgcgccgcgcgtggtgccctactttaccgacgcctcg
ctgctgctgcctgcattgggcgatccgccctgtattattctcggccccggcgagccgtcg
atggcgcatcaaaccgacgagtactgcctgctcagccgactggcggaggcagaacagcta
tacggtgacattattcgcgactggatggcatcaccgcccgcgacgaaagtaaaaaatgag
tga

DBGET integrated database retrieval system