KEGG   Klebsiella pneumoniae 342: KPK_2995Help
Entry
KPK_2995          CDS       T00772                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase PaaF
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00071  Fatty acid degradation
kpe00280  Valine, leucine and isoleucine degradation
kpe00281  Geraniol degradation
kpe00310  Lysine degradation
kpe00360  Phenylalanine metabolism
kpe00362  Benzoate degradation
kpe00380  Tryptophan metabolism
kpe00410  beta-Alanine metabolism
kpe00627  Aminobenzoate degradation
kpe00640  Propanoate metabolism
kpe00650  Butanoate metabolism
kpe00903  Limonene and pinene degradation
kpe00930  Caprolactam degradation
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01120  Microbial metabolism in diverse environments
kpe01130  Biosynthesis of antibiotics
kpe01212  Fatty acid metabolism
Module
kpe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPK_2995 (paaF)
   00650 Butanoate metabolism
    KPK_2995 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    KPK_2995 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPK_2995 (paaF)
   00310 Lysine degradation
    KPK_2995 (paaF)
   00360 Phenylalanine metabolism
    KPK_2995 (paaF)
   00380 Tryptophan metabolism
    KPK_2995 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPK_2995 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KPK_2995 (paaF)
   00281 Geraniol degradation
    KPK_2995 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPK_2995 (paaF)
   00627 Aminobenzoate degradation
    KPK_2995 (paaF)
   00930 Caprolactam degradation
    KPK_2995 (paaF)
Enzymes [BR:kpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KPK_2995 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACI06697
UniProt: B5XRJ7
Position
complement(3047715..3048482)
Genome map
AA seq 255 aa AA seqDB search
MSDLLIHRHGPVLQLTLNRPQARNALNNALLTQIAEVLEAASIDDSVGVCVISGNARFFA
AGADLNEMAEKDLPATLDDIRPRLWGRIDAFTKPLIASVNGYALGAGCELALLCDLIVAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKALASRMVLSGESIDAHQAQQAGLVSDIHPA
ALTDEYALKLAATIARHSPLALRAAKQSLRLSQEVSLQAGLQQERQLFSLLSATEDRREG
IDAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacctgctgatccaccgtcatggcccggtgcttcagctgacgctgaaccgcccg
caggcccgcaacgcgctgaacaatgccctcttaacccagattgccgaggtgctggaggca
gcgtcaattgatgacagcgtcggcgtctgcgttatcagcggtaacgcgcgttttttcgcc
gccggggctgacctcaacgaaatggctgaaaaagatctgcctgccacccttgatgatatt
cgcccacggttgtgggggcgaatcgatgcctttactaaaccgctcatcgcttcggtcaac
ggctacgcgctgggcgccggctgcgagctggccctgctgtgcgacctgattgtcgccggt
gacaacgcccgttttggcctgccggaaattaccctcggcattatgccgggcgctggcggc
acccagcggctgatccgcagcgttggcaaggcgctggccagccggatggtgctgagcggc
gagagtattgacgcccaccaggcgcagcaggccggactggtcagcgatatccatccggcg
gcgttaaccgatgagtatgccctgaagctggccgccaccatcgcccgccattcgcctctg
gcgctacgggcggcaaaacagtcgctgcgcctgtcgcaggaagtcagcctgcaggctggt
ctgcaacaggagcgtcagctgtttagcctgctgagcgccaccgaggaccgccgcgaaggc
atcgacgccttcttacaaaaacgtacaccggactttaaaggacgctaa

DBGET integrated database retrieval system